KEGG   Nitrosomonas sp. Is79A3: Nit79A3_1906Help
Entry
Nit79A3_1906      CDS       T01569                                 

Definition
hypothetical protein
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
nii  Nitrosomonas sp. Is79A3
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:nii00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Nit79A3_1906
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nit79A3_1906
   00020 Citrate cycle (TCA cycle)
    Nit79A3_1906
   00620 Pyruvate metabolism
    Nit79A3_1906
Enzymes [BR:nii01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Nit79A3_1906
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2033430..2034740)
Genome map
AA seq 436 aa AA seqDB search
MAELKKVLIPDIGDFKDVPVIEVLVKAGDEIKVEDSLVTLESDKATIEIPSPYSGLIKEI
FVKSGDKVSEGTAVLAIEVSNSINEITPKQVSEIEPVKKDVTTQTEIAIKQAAVQQTLKL
SQQNTLTVSSTFSQAHASPSIRRFARELGTNLNLITGSGPKHRILKEDVQAYVKTELSKA
RSNGTGLALNLLPWPQVNFAKFGPIELKPLTRIKQISGANLHRNWVMIPHVTQFDEADIT
DLEALRKESNESDKENKVKLTLLAFLMKALVAPLKKFPEFNASLDNNADGEANLIIKHFY
HIGFAVDTINGLMVPVIKDVDQKGIITIAEELTRLSLLAREGKLKPNDMQGASFTISSLG
GIGGTAFTPIINAPEVAILGISKASIKPVYRDHQFIPRLMLPLSLSYDHRVIDGATAARF
TTHLAEVLTDMRLALL
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
gtggctgaattaaagaaagtattaattcctgatatcggtgatttcaaagatgttccagta
attgaggttctggtaaaagcaggcgatgaaattaaagttgaagattcactggttacgctg
gaatccgataaagctaccatagaaatcccgtccccatattcaggtttaattaaggaaatc
tttgtcaaatcaggtgacaaagtgtccgaaggcactgcggttctagccattgaagtttca
aatagcattaatgagatcactcccaaacaagtttctgaaattgagccagttaagaaagat
gttacaacgcaaactgaaattgcaataaagcaagccgccgttcaacaaacactgaaatta
tcgcaacaaaatacactcacagtcagcagcactttttctcaagcacatgccagcccatcc
atacgccgtttcgcaagggaattgggtacaaacctcaatttgatcacaggtagtggtcct
aaacatcgcatcctcaaagaagatgttcaggcctatgtaaaaaccgaattatcaaaagca
cgaagcaatggaacaggactcgcgcttaatttactaccttggccacaggttaattttgcc
aaatttggtccgatagaattaaaacctttaacacgcattaaacaaatctccggcgccaat
ttgcaccggaattgggtaatgattccacatgtgacccagtttgacgaagctgatatcact
gatttagaggctttacgaaaagaatccaatgaaagcgataaagaaaataaagtgaaattg
acattattggcttttttgatgaaagcattggtagcgccgctgaaaaaatttccagaattc
aatgcttccctcgataataatgcagatggcgaagctaatctaatcattaagcatttctat
catatcggttttgccgtcgatacgatcaatggattaatggttcctgtcattaaagatgtt
gatcagaaaggaatcataactattgccgaagaattgacaagactttctttactagcacgt
gaaggtaaattaaaaccaaacgatatgcaaggcgcaagttttaccatttctagcttgggt
ggaattggcggcacagcatttaccccgattatcaatgcacctgaagttgccattctgggt
atttcaaaggcaagtattaagcctgtctatcgcgaccatcagttcattccacggttaatg
cttcccttgtcactttcctatgatcaccgagtcattgatggtgcaactgcggcgcgtttt
acgactcatttggcggaagtgttgacggatatgcgcttggctttattataa

DBGET integrated database retrieval system