KEGG   Nitrosomonas sp. Is79A3: Nit79A3_1906Help
Entry
Nit79A3_1906      CDS       T01569                                 

Definition
(GenBank) catalytic domain-containing protein of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
nii  Nitrosomonas sp. Is79A3
Pathway
nii00010  Glycolysis / Gluconeogenesis
nii00020  Citrate cycle (TCA cycle)
nii00620  Pyruvate metabolism
nii01100  Metabolic pathways
nii01110  Biosynthesis of secondary metabolites
nii01120  Microbial metabolism in diverse environments
nii01130  Biosynthesis of antibiotics
nii01200  Carbon metabolism
Module
nii_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:nii00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nit79A3_1906
   00020 Citrate cycle (TCA cycle)
    Nit79A3_1906
   00620 Pyruvate metabolism
    Nit79A3_1906
Enzymes [BR:nii01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Nit79A3_1906
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H CAT
Motif
Other DBs
NCBI-ProteinID: AEJ01704
UniProt: F8GJZ5
Position
complement(2033430..2034740)
Genome map
AA seq 436 aa AA seqDB search
MAELKKVLIPDIGDFKDVPVIEVLVKAGDEIKVEDSLVTLESDKATIEIPSPYSGLIKEI
FVKSGDKVSEGTAVLAIEVSNSINEITPKQVSEIEPVKKDVTTQTEIAIKQAAVQQTLKL
SQQNTLTVSSTFSQAHASPSIRRFARELGTNLNLITGSGPKHRILKEDVQAYVKTELSKA
RSNGTGLALNLLPWPQVNFAKFGPIELKPLTRIKQISGANLHRNWVMIPHVTQFDEADIT
DLEALRKESNESDKENKVKLTLLAFLMKALVAPLKKFPEFNASLDNNADGEANLIIKHFY
HIGFAVDTINGLMVPVIKDVDQKGIITIAEELTRLSLLAREGKLKPNDMQGASFTISSLG
GIGGTAFTPIINAPEVAILGISKASIKPVYRDHQFIPRLMLPLSLSYDHRVIDGATAARF
TTHLAEVLTDMRLALL
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
gtggctgaattaaagaaagtattaattcctgatatcggtgatttcaaagatgttccagta
attgaggttctggtaaaagcaggcgatgaaattaaagttgaagattcactggttacgctg
gaatccgataaagctaccatagaaatcccgtccccatattcaggtttaattaaggaaatc
tttgtcaaatcaggtgacaaagtgtccgaaggcactgcggttctagccattgaagtttca
aatagcattaatgagatcactcccaaacaagtttctgaaattgagccagttaagaaagat
gttacaacgcaaactgaaattgcaataaagcaagccgccgttcaacaaacactgaaatta
tcgcaacaaaatacactcacagtcagcagcactttttctcaagcacatgccagcccatcc
atacgccgtttcgcaagggaattgggtacaaacctcaatttgatcacaggtagtggtcct
aaacatcgcatcctcaaagaagatgttcaggcctatgtaaaaaccgaattatcaaaagca
cgaagcaatggaacaggactcgcgcttaatttactaccttggccacaggttaattttgcc
aaatttggtccgatagaattaaaacctttaacacgcattaaacaaatctccggcgccaat
ttgcaccggaattgggtaatgattccacatgtgacccagtttgacgaagctgatatcact
gatttagaggctttacgaaaagaatccaatgaaagcgataaagaaaataaagtgaaattg
acattattggcttttttgatgaaagcattggtagcgccgctgaaaaaatttccagaattc
aatgcttccctcgataataatgcagatggcgaagctaatctaatcattaagcatttctat
catatcggttttgccgtcgatacgatcaatggattaatggttcctgtcattaaagatgtt
gatcagaaaggaatcataactattgccgaagaattgacaagactttctttactagcacgt
gaaggtaaattaaaaccaaacgatatgcaaggcgcaagttttaccatttctagcttgggt
ggaattggcggcacagcatttaccccgattatcaatgcacctgaagttgccattctgggt
atttcaaaggcaagtattaagcctgtctatcgcgaccatcagttcattccacggttaatg
cttcccttgtcactttcctatgatcaccgagtcattgatggtgcaactgcggcgcgtttt
acgactcatttggcggaagtgttgacggatatgcgcttggctttattataa

DBGET integrated database retrieval system