KEGG   Nitrosomonas sp. Is79A3: Nit79A3_1990Help
Entry
Nit79A3_1990      CDS       T01569                                 

Definition
Histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
nii  Nitrosomonas sp. Is79A3
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nii00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Nit79A3_1990
  Amino acid metabolism
   00340 Histidine metabolism
    Nit79A3_1990
Enzymes [BR:nii01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Nit79A3_1990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2141511..2142815
Genome map
AA seq 434 aa AA seqDB search
MIRIKRFNSTDPDFNSNLEKLLAFENAQDDTVDVTVAKILADIRNRKDAALIEYTNRFDR
LSATTGKDLELTQKQLHHSLETLPSNQRNALEQAAERVRSYHEKQQLNSWQYTDSDGTLL
GQKITPLDRVGLYVPGGKASYPSSVLMNAIPAKVAGVKELIMVVPTPGGERNDMVLAAAA
ISQVDRVFTIGGAQAVGALAYGTETIPQVDKIVGPGNAYVAAAKRRVFGVVGIDMVAGPS
EILVICDGKTDPDWIAMDLFSQAEHDELAQAILLSPDAEFLDQVMRSIDRLLSGMPRKDV
IRASLENRGALIQVQSFDEACAIANRIAPEHLELSVDQPEIWLDKIRHAGAIFLGRNACE
ALGDYCAGPNHVLPTSRTARFSSPLGVYDFQKRSSLIQVSQQGAAKLGEIASVLAYGEGL
QAHARSAEYRYKNR
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgattcgaataaaacgattcaattcaaccgatcctgatttcaattccaatcttgaaaaa
ctattggcttttgagaatgcgcaagatgatacggtcgatgtcactgtcgccaagattctt
gccgacatcagaaaccgcaaagatgcagccttgatcgaatacaccaaccgttttgaccgg
ctttcagcaacaaccggcaaagatctcgaactgacgcagaagcaattgcatcattcttta
gaaactttaccgtcgaaccagcgtaatgcactggaacaggctgcagagcgcgttcgcagt
taccatgagaaacagcaattgaattcatggcagtacacggattccgacggtacgttgtta
ggccaaaaaataaccccgctggatcgtgtaggcctttatgtccctggcggcaaagcttcc
tacccgtcgtccgttctgatgaatgccatccccgcgaaagtggccggtgtgaaggagctg
atcatggttgtacccacaccgggcggggaaagaaacgacatggtcctggcagcggctgca
atcagtcaggttgaccgggtttttaccatcggcggcgcccaagctgtcggtgcgctggcg
tatggcactgaaacgatcccgcaagtggacaagatcgtgggtccggggaatgcttatgtc
gctgccgcaaaacgccgggtattcggtgtcgtcggtattgatatggttgccggtccttct
gaaattctggttatctgtgacggcaaaacagatcccgactggattgccatggatttattc
tcacaagctgaacacgatgaactcgcgcaagcaattttattatctcccgatgcggaattt
ctcgatcaggtaatgcgcagtattgatcgcttgttatccggaatgccgcgcaaagatgtc
atccgcgcttcactggaaaatcgcggcgctttgattcaagtacaaagcttcgatgaggcc
tgtgcgatcgctaatagaattgcgcctgagcacttggaattatctgtcgatcaaccggaa
atttggttggataaaatccgccatgccggcgctattttcctcggccgtaatgcgtgtgaa
gcgcttggagattattgtgccggtcctaaccatgttttaccgacatcacggacagcacgg
ttttcttccccattgggtgtctatgatttccagaagcgcagcagtcttattcaggtctct
cagcagggtgctgcaaaacttggagaaattgcatccgttctagcctatggagagggctta
caggctcatgccaggtcagcagaatatcgttataaaaatcgataa

DBGET integrated database retrieval system