KEGG   Nitrosomonas sp. Is79A3: Nit79A3_2035Help
Entry
Nit79A3_2035      CDS       T01569                                 

Definition
DNA polymerase III chi subunit HolC
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
nii  Nitrosomonas sp. Is79A3
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:nii00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:nii00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:nii03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:nii03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:nii03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2190936..2191358
Genome map
AA seq 140 aa AA seqDB search
MTQIFFYSGSNDKLQTACRLCSKAVKQNMKVMVYTPDAAVLAKFNDLLWTFSPTSFIPHC
AIQDDPQLVSVTPVILSNQIPPDSQYDVLLNLHQQHPPSFNQFKRIIEIAGISHEDKLAA
RERFRLYKDSGYEIQHFNLD
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgactcaaatttttttctactcgggatccaacgataaactacaaacagcctgccggctt
tgctccaaggctgtcaaacaaaatatgaaagtaatggtttatacccctgatgcggcagta
cttgcaaaattcaatgacttactttggacgttctcccccactagctttatcccgcattgt
gctattcaagatgatcctcagttggtcagtgtaacacctgttattttgagtaaccagata
ccaccggatagccagtatgacgtgctgcttaatctacatcagcaacatccgccttcattc
aatcagttcaaaagaatcatagagatagcaggtatttctcatgaggataaactggcagcc
cgcgaacgtttccgtctttataaagatagcggctatgagatacagcatttcaaccttgat
tga

DBGET integrated database retrieval system