KEGG   Nitrosomonas sp. Is79A3: Nit79A3_2035Help
Entry
Nit79A3_2035      CDS       T01569                                 

Definition
DNA polymerase III chi subunit HolC
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
nii  Nitrosomonas sp. Is79A3
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:nii00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Nit79A3_2035
   00240 Pyrimidine metabolism
    Nit79A3_2035
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Nit79A3_2035
   03430 Mismatch repair
    Nit79A3_2035
   03440 Homologous recombination
    Nit79A3_2035
Enzymes [BR:nii01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Nit79A3_2035
DNA replication proteins [BR:nii03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     Nit79A3_2035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2190936..2191358
Genome map
AA seq 140 aa AA seqDB search
MTQIFFYSGSNDKLQTACRLCSKAVKQNMKVMVYTPDAAVLAKFNDLLWTFSPTSFIPHC
AIQDDPQLVSVTPVILSNQIPPDSQYDVLLNLHQQHPPSFNQFKRIIEIAGISHEDKLAA
RERFRLYKDSGYEIQHFNLD
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgactcaaatttttttctactcgggatccaacgataaactacaaacagcctgccggctt
tgctccaaggctgtcaaacaaaatatgaaagtaatggtttatacccctgatgcggcagta
cttgcaaaattcaatgacttactttggacgttctcccccactagctttatcccgcattgt
gctattcaagatgatcctcagttggtcagtgtaacacctgttattttgagtaaccagata
ccaccggatagccagtatgacgtgctgcttaatctacatcagcaacatccgccttcattc
aatcagttcaaaagaatcatagagatagcaggtatttctcatgaggataaactggcagcc
cgcgaacgtttccgtctttataaagatagcggctatgagatacagcatttcaaccttgat
tga

DBGET integrated database retrieval system