KEGG   Nitrosomonas sp. Is79A3: Nit79A3_2089Help
Entry
Nit79A3_2089      CDS       T01569                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
nii  Nitrosomonas sp. Is79A3
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nii00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Nit79A3_2089
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Nit79A3_2089
Enzymes [BR:nii01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     Nit79A3_2089
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2240078..2241331
Genome map
AA seq 417 aa AA seqDB search
MQKLIIQGGKPLQGEITISGAKNAALPVLCAALLTRESLKVSNVPALQDITTMLSLLEQM
GTSITAHDSSEVVLSADKLTNLIAPYEMVKTMRAAILVLGPLLARAGEANISLPGGCAIG
LRPVDQHIKGLQTMGAEISIKHGYIHAVAKKLHGARIVFDIVTVTGTENLMMAATLADGT
TILENAAREPEIVDLANCLTAMGAKIHGAGSDIITIEGVSSLHGAEHTVMPDRIETGTFL
VAATATGGEIHLKYTHSHLLDAVLDKLTEAGAQIDSGENWIHLKMSAKPKSVNLRTAPYP
AFPTDMQAQFMSLNCIASGTAIITETIFENRLMHVQELKRMNANIEVEGNAAIVYGISQL
DGAHVMATDLRASASLVIAGLIAQGETVIDRIYHLDRGYENIEGKLSALGAQICRAS
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaactgattatccagggtggcaaaccattacagggtgaaattaccatctcgggc
gcgaaaaatgctgcgcttcctgttttatgtgctgcacttctaacccgagaatctttaaaa
gtaagtaatgtcccggctctgcaagacattaccaccatgttgtcattgctcgaacaaatg
ggaacaagcatcacagcgcacgattcatcggaagtcgtgctgtcagcagataaactgacc
aatctgatcgctccgtatgagatggttaaaaccatgcgcgcagcaattctggtgcttggt
ccactccttgcccgcgccggagaagctaatatttcattaccaggcggttgtgccatcggg
ctacgtccggttgatcagcatatcaaagggctgcaaactatgggcgcggaaatcagcatc
aaacatggatacatccatgccgtggcaaagaaactgcatggtgcacgcattgtatttgat
attgtcaccgtcactggaacagaaaatttaatgatggcggccacattagcggatggcaca
accattctggagaatgccgcacgcgaaccggaaatcgttgatcttgccaattgcttgacg
gcaatgggcgcaaaaattcatggcgctggcagtgacatcataacgattgaaggtgtgtct
tcgctccatggtgcagaacacactgtaatgccagatcgaatcgaaacgggaactttttta
gttgcggccacagctaccgggggcgaaattcatttaaagtacacccattctcacttactt
gatgctgttctggacaaactgaccgaagctggcgcccagattgattccggtgaaaattgg
attcacctgaaaatgtccgcaaaacccaaatcggttaatttacgcacggccccctacccg
gcctttccaaccgacatgcaggcgcaattcatgtccttgaattgtattgccagcggaact
gccatcatcactgaaactatttttgagaaccggttgatgcatgtgcaggaattaaaacgc
atgaatgccaatatcgaagtggaaggcaatgctgccattgtctacggtatttcccagctg
gatggcgcacatgttatggccaccgatttacgggcgtcggccagtctggtgattgcagga
ttgatcgctcaaggtgaaaccgtgattgatcgtatctaccacctggatcgcggttatgaa
aatattgaagggaagttatctgcgctgggtgcgcaaatctgccgcgcaagctag

DBGET integrated database retrieval system