KEGG   Nitrosomonas sp. Is79A3: Nit79A3_2199Help
Entry
Nit79A3_2199      CDS       T01569                                 

Definition
chemotaxis protein CheR (EC:2.1.1.80 3.1.1.61)
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
nii  Nitrosomonas sp. Is79A3
Pathway
Two-component system
Bacterial chemotaxis
Module
CheA-CheYBV (chemotaxis) two-component regulatory system
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:nii02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:nii02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2357757..2360678
Genome map
AA seq 973 aa AA seqDB search
MTHQDKVDINPNTETDTFPIVGIGASAGGLNAFTQLLKALPIDTGMAFVLIQHLDPKHIS
LLPDLIKRTTAMPVIEISDNLRVEPNHIYVMPPTHSLALLHGVLQLLPRPDVWGKFLPID
DFLTSLAQDRQNHAIGIILSGTASDGTLGIQAIKTVGGITFAQSEDSAEYDGMPHSAIAS
GHVDFILPPKEIARKLAQIAHHPYLKQQLVKLAEDVPAKETNLGKIFVLLRARTGIDFTY
YKHTTILRRIKRRMMLHQLDEMKDYVKFLRQHPKELDILFQDMLINVTSFFRDPEAFEVL
KKEIFPRLIEQLANERALRIWIPACSTGEEVYSIAIALFEFLGNQVNAMHIQIFASDIDK
QAIDKARQGIYSHHIDETVGIERLARFFIKTTNGYQICKSIRDVCVFAIQNVIQDPPFSR
INLICCRNLLIYLNTPIQKRVLNTFFYALRPNGFLMLGTSETIGSEADLYSLIDRKNKIY
LRKSQANPPNTDLAKILSTSPSVSTFHFHSKDAPPAMQVQQAAENIILTKYGPPAVVIDQ
NMHILYFRGQTGPYIEPTTGSASLNLLKMVHPELIIELRALVHQAIKENNIVRKEGLRMH
HNGSYKNINLQIIPLVSPKTMMPSYLVVFEPGAEIPARQNPLQPEDSCRDARDLRISTLE
NELLTEREYMQSIIEEQEGTNEELQSANEEIQSANEELQSINEELETTKEELQSTNEELT
TIIEEHENRNQELNQVNNDLINLLASIDTPIVILHKNLSIRRFTPAAKVLLNLIDTDTNR
PISNIRPNIAIPDLESELKQVIESAVTKSIEVQDDNGHWYLLRLHPFEKQDKNIDGVVMV
FIDIDAIKDIEQLRNALQYERRLAAVVRDSNDAVTVQDFNGHILAWNQRATEMFGYTEDE
ALQLNANQLIPDIAREEMRTLLEQLQHGQKTPPCETIRCTKEGHLLKVWMTTSILNNGAG
NPAAIAITEREIL
NT seq 2922 nt NT seq  +upstreamnt  +downstreamnt
atgacgcatcaggataaagtggatatcaatccaaatacagaaacagacacattcccaata
gtgggtatcggcgcctctgcgggaggattaaatgcatttacccaactgctcaaagcactt
cctatcgacactggcatggcctttgttctgatccagcatcttgaccctaaacatatcagc
ctattacctgatctgataaaacgtaccacggcaatgcccgtgatcgaaataagcgataat
ctgcgtgttgagcccaatcatatttatgtgatgccaccgacacatagcttggcactgctg
cacggtgtattgcaattgctcccacgtccggatgtatggggtaaattcctgcccattgat
gattttctaaccagtcttgcacaagaccggcaaaatcatgccattggaattattctttca
ggcacagcatccgatggcactttgggtatacaagccatcaagacagtgggcggtattacc
tttgcacaatctgaagattcggcggaatatgatggaatgccgcacagtgcaatcgctagc
gggcatgtggattttatcctgccacctaaggaaattgcccgtaaattggcgcaaatagcg
catcatccctatttaaaacaacagttagttaagcttgcagaagatgtgccagccaaagaa
acgaacctcggtaaaattttcgttctgctgcgcgcgcgcaccggtatcgactttacttac
tacaagcacacgaccattctgcgtcgtattaaacggcgcatgatgctacaccaactggat
gaaatgaaagattatgtcaagtttctgcggcagcacccaaaggaactggacatattgttt
caggacatgctgatcaatgtcacgagcttctttcgcgatccagaagcttttgaggttctc
aagaaagaaatatttcctcgtctcattgaacaactggcaaatgaaagagcacttcgtatt
tggatacccgcttgttcaacgggtgaagaggtttattcaatagccattgcgctatttgaa
tttctcggtaatcaagttaatgccatgcatattcagatctttgcttcagatatcgataag
caagcgatcgacaaagcacgccaagggatctattcacatcacatcgatgagactgttgga
attgagcggcttgcgcggttttttatcaaaacaacaaacggttaccagatctgcaaaagt
atccgggatgtctgcgtatttgcgatacagaatgttatccaagacccccctttctcccgg
ataaatctgatttgctgccgcaatctgttgatttatctcaatacaccaatacagaaaaga
gtattaaacacttttttctatgcgctacgtccgaatggtttcctgatgttaggcacttct
gaaacgattggtagcgaagccgatctttactctttaattgacaggaagaataagatttat
ttgcgtaaatctcaggcaaatccacctaatactgatttagccaaaatactctctacatct
ccatcagtttcgacatttcattttcactcaaaggacgcaccaccggcaatgcaagtgcaa
caagcagctgaaaatataattctgacaaaatatgggccaccggcggtagtaatcgaccag
aatatgcatatactctatttccgtggccaaaccggcccctacattgagccaactactggg
agcgcaagtctcaacttgttgaaaatggtgcatccggaactgataatagaactacgagca
cttgtccatcaagccatcaaggaaaacaacattgttcgcaaggaaggcttgcgcatgcat
cataatggaagctataaaaatataaatttgcaaataatacccctcgtcagtccaaaaact
atgatgccaagttatttggtcgtatttgaacctggcgctgaaatccccgctaggcagaac
ccattacagccagaagactcgtgtagagatgctagagatcttcgcattagtactttggaa
aatgaattacttaccgaacgggagtatatgcaatcgattattgaagaacaggaaggaacc
aatgaagaattgcagtctgctaatgaagaaatccaatccgccaacgaagaattgcaaagt
attaacgaagaattagaaactactaaagaagaattacagtccaccaatgaagaactgacc
accatcatcgaagagcatgaaaatcggaatcaagaattaaatcaagttaacaacgaccta
atcaatctactggctagcattgatacgcccattgtcattctgcacaaaaacttatctatc
cggcgatttactcctgctgcaaaagtactgctgaatcttatcgataccgacaccaatcgg
ccgatcagtaatattcggcctaatatcgctatcccggatttggaaagcgaactcaaacaa
gtgatagaatcggctgtcacgaaatccattgaggtacaggatgataatgggcattggtac
ttattgcgactacaccctttcgagaaacaggataaaaacatcgacggtgtcgtaatggta
tttattgatattgatgcaattaaagatatcgaacagttacgtaatgcacttcaatatgaa
cgccgtttggcggcggtagtccgcgattctaacgatgcagtaacagtccaggattttaac
ggccatatcctggcatggaaccagcgtgcaacagaaatgtttggatataccgaagacgaa
gcactacagcttaatgccaatcaattgatcccagacatagcccgagaagaaatgcgtact
ttgttggagcaacttcaacacggccagaaaacacccccttgcgaaaccatacgttgcact
aaagaaggccatttactcaaggtgtggatgacgacatcaatcctgaataacggcgcgggt
aatccagcggccattgcaatcaccgaacgggagatcctataa

DBGET integrated database retrieval system