KEGG   Nitrosomonas sp. Is79A3: Nit79A3_2382Help
Entry
Nit79A3_2382      CDS       T01569                                 

Definition
Glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
nii  Nitrosomonas sp. Is79A3
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:nii01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:nii00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2541594..2542703
Genome map
AA seq 369 aa AA seqDB search
MIKQARRIVIKVGSSLVTNQGKGLDHAALACWAAQIANLKQMGKEIILVSSGAIAEGMQR
LNWESRPTALYELQAAAAVGQMGLAQAYASSFSEYGLQTAQVLLTHEDLSNRKRYLNARS
TLTTLLKLNIIPIINENDTVAIDEIRFGDNDTLAALVTNLVEADVLIILTDQAGLFTSDP
RKNPDAKLLSEVNAGDPALEKMAGGVGSGISRGGMQTKVIAAKRAARSGADTIVASGHED
NVLVRLNQDEAIGTRFLAKIPVLAARKQWLADYLQVRGSVILDQGAVKALSADGKSLLPI
GVISVDGEFERGEAVSCRDEAGREIARGLINYSAVETQKILKQASNEIEAILGYVDEPEL
IHRNNLVLL
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgataaagcaagcacgccgtattgtcattaaagtaggtagcagcctggtcaccaatcaa
ggcaaggggctcgaccacgctgcactggcctgttgggcagcacaaattgcaaaccttaaa
caaatgggcaaggaaatcatcctggtctcttcgggtgcaatcgccgaaggcatgcagcga
ttaaattgggaaagccgccccactgcattatatgaattgcaggctgcagccgccgttgga
caaatgggtctggcgcaggcctatgcatccagcttttctgagtatggtttgcaaaccgcc
caagtgcttctgacccatgaagacttgtcgaaccggaaacgttatctgaacgcgcgctca
accctaacaacattattaaaactaaacattattccaatcatcaatgagaatgataccgtt
gcgattgatgaaattcgttttggcgacaatgacactctggcggcgctggtcactaatctg
gttgaagccgatgtgctgattattctgactgatcaggccggtttatttaccagtgaccct
cgcaagaatccggatgcgaaattattaagcgaagtaaatgctggtgaccccgcacttgag
aaaatggccggtggcgttggcagcggtatcagtcgtggcggaatgcaaactaaagtaatc
gccgccaagcgtgcggcacgtagtggcgcggataccatcgtcgcatcaggccatgaagac
aacgtgctagtccgccttaaccaggacgaggctatcggcacccgtttcctggccaaaata
ccggtattggcagcacgtaagcaatggcttgctgactatttacaagtacgcgggtctgtg
atactggatcaaggcgctgtgaaggcgctttcagcagatggcaaaagcctgctccccatt
ggcgttatcagcgtcgacggtgaatttgagcgtggagaagccgtatcttgccgcgatgaa
gcaggcagagagatagcccgcggtttgattaactatagcgctgttgaaacacaaaaaatc
ctaaaacaggccagcaatgaaatcgaagccatactgggttatgttgatgaaccggaactc
attcacagaaataatctggtcttgctttag

DBGET integrated database retrieval system