KEGG   Nitrosomonas sp. Is79A3: Nit79A3_2469Help
Entry
Nit79A3_2469      CDS       T01569                                 

Definition
(GenBank) Tryptophan synthase alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
nii  Nitrosomonas sp. Is79A3
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:nii00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Nit79A3_2469
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Nit79A3_2469
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Nit79A3_2469
Enzymes [BR:nii01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Nit79A3_2469
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2618837..2619700)
Genome map
AA seq 287 aa AA seqDB search
MSLDIIKNLMNFFSGQSDTKEINRIAKTFTALKKQNRKALIPFITAGDPNPGITVQLMHQ
LVQSGANIIELGIPFSDPMADGPTIQRSSERALKHHVSLNNVLDMVAEFRKTDRDTPVVL
MGYANPIEASGYELFAGKAKDCGVDGVLIVDYPPEESGEWVQCLDRHGIDAIFLLSPTTP
QERIEQVAVMAKGYIYYVSLKGVTGASHLDLQDVSAMLKQLRQHISLPIGVGFGIRDGAT
AKAVAGLADAVVVGSRIIEEIEKSPDTELLNNVGNLLSTLRKAIDEN
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgagcctagatattatcaagaatttaatgaatttttttagtggacaaagcgatactaaa
gaaataaatcgtattgctaaaacattcaccgctttaaaaaaacagaatcggaaagcttta
attccatttatcacggcaggcgatcccaatcccggaatcacggtacagttaatgcaccag
ctcgtacaatcaggcgctaatatcatagaattaggcatacctttttcagatccgatggcc
gatggacctacgatacaaagatcttctgaacgtgctttaaaacatcatgtgagcctgaat
aatgtattggatatggtggccgaattcagaaaaacggatagggacacgcctgtggttttg
atgggatatgcaaatcctattgaagcatctggctatgaattgtttgcgggcaaagcaaaa
gattgtggtgtcgatggtgttctaatcgttgactatccccctgaagaatcgggcgaatgg
gtgcaatgcctggatcggcatggaattgatgcaatctttttgctgtctcccacaacgccc
caggaacgtattgagcaagtggcagtaatggctaaaggttatatttattatgtttcgtta
aagggtgtgaccggagcatcacatcttgatcttcaagatgttagcgcaatgttgaagcag
ctgcgtcagcatatttcacttccgattggtgttggattcggtattcgtgacggagcaaca
gccaaagcagtggccggtctggcggacgcagtggtggttggtagtcgaattattgaagaa
attgagaaatctccggatacggagctactgaataatgtaggaaacttgttaagcacgttg
cgcaaagccatcgatgaaaattaa

DBGET integrated database retrieval system