KEGG   Nitrosomonas sp. Is79A3: Nit79A3_2470Help
Entry
Nit79A3_2470      CDS       T01569                                 

Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
nii  Nitrosomonas sp. Is79A3
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:nii00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Nit79A3_2470
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Nit79A3_2470
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Nit79A3_2470
Enzymes [BR:nii01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Nit79A3_2470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2619766..2620965)
Genome map
AA seq 399 aa AA seqDB search
MSAYDLPNKNGHFGPYGGIFVAETLISALEDLRKQYEFYRDDPDFQAEFAYELKHYVGRP
SPIYHAKRWSEHLGGAQILLKREDLNHTGAHKINNTIGQALLARRMGKKRVIAETGAGQH
GVASATVAARYGMECVVYMGSEDVRRQATNVYRMKLLGATVVPVESGSRTLKDALNEAMR
DWVTNVENTFYIIGTVAGPHPYPMMVRDFQAIIGKEAKVQMQEDFNRQPDALIACVGGGS
NAIGLFYPYIDDVNVRLIGVEAAGKGIDTNQHAATLSTGRPGVLHGNRTYLIQDENGQII
ETHSISAGLDYPGVGPEHAWLKDCGRAEYVAITDDEALEAFHTLCRYEGIMPALESSHAL
AYAAKFASTLSKDKLLLVNLSGRGDKDMATVAQMSGLTL
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgcttacgatctccccaataagaatggtcactttggaccttacggaggcatattt
gttgctgaaacattaatttcggcactggaggatttacgcaagcagtatgaattttatcgt
gatgatccggattttcaggcagagtttgcctatgagttaaaacattatgtaggacgtccc
agtccaatctatcacgccaaaagatggtctgagcatttgggcggtgcgcaaatactgttg
aaacgtgaagatttgaatcataccggcgcgcataaaatcaacaatacaatcggacaagca
ttgctagcccggcgcatgggaaagaaacgcgtcattgctgaaacaggtgccggtcagcat
ggtgtggccagtgcgacagtggcggcgcgttatgggatggaatgcgttgtttatatgggt
tctgaagatgttaggcggcaagcaaccaatgtctatcgcatgaaactcttgggtgcaaca
gttgtgccggtagaatcgggatctcgaactttaaaagatgcattaaatgaggccatgcgt
gactgggttactaatgttgagaacactttttatatcattggcacagtcgccggaccgcac
ccctatccgatgatggtcagggattttcaggcgattataggaaaagaggccaaggtgcaa
atgcaagaggattttaataggcaaccggatgcgctcattgcttgtgtcggtgggggatca
aatgcaatcgggttattctatccgtatattgatgatgtgaatgtccggttgattggtgtg
gaagcagcgggaaaaggtattgataccaaccagcatgcagcgaccttatcaacgggtagg
cctggagtattacatggaaaccgtacctatctcatccaggatgagaatggtcagattatt
gaaacacattctatatcagccggtcttgattaccccggcgttgggccggaacatgcttgg
ctgaaagattgcgggcgtgcagaatatgttgcaattaccgatgatgaggcgctagaagca
tttcatacactttgtcgttatgaaggcataatgcctgcgttggaatcaagtcatgctctg
gcttatgccgctaagtttgcgtctacattgtcgaaagacaaattactgctggttaatctg
tccggccggggtgacaaggatatggcaactgttgcgcaaatgtccgggttaacgctctag

DBGET integrated database retrieval system