KEGG   Nitrosomonas sp. Is79A3: Nit79A3_2608Help
Entry
Nit79A3_2608      CDS       T01569                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
nii  Nitrosomonas sp. Is79A3
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:nii00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Nit79A3_2608
Enzymes [BR:nii01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Nit79A3_2608
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2792111..2792728
Genome map
AA seq 205 aa AA seqDB search
MTKMTGCLFIISAPSGTGKTSLVRALLQSDLNLSLSISHTTRPPRSGEVNGRDYHFVDEE
TFRQMLRNGEFVESAEVYGNLYGTSQKWIDSAIASGQDILLEIDCQGAKQIQQILPGSIG
IFILPPSANTLATRLKTRAQDNPGIIEKRLVAAREEVGHITEFDYVIINDKLEDALNDLI
CIVRAEHLKKARQLIKYHELIAQLS
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaatgacaggctgcttatttattatcagcgcaccctctggcaccggaaaaacc
agtttggtcagagcgttactccagtcggacttaaatctgagtctgtctatttcacatacc
acacgcccgccacgttctggagaagtcaatggccgtgactatcattttgtcgatgaagaa
acattcagacaaatgctccgcaacggagaattcgtggaaagtgcagaagtttatggcaat
ctttatggcacctcgcaaaaatggattgatagcgctatcgcatccgggcaggatatttta
ctcgagattgattgccagggagcgaaacagatccagcaaattctccccggatccattggc
atctttattctcccgccatctgctaacactctggcaacgcgactaaaaacaagagcgcaa
gataatccgggaatcattgagaaaagacttgttgcagcacgcgaagaagtcggtcatatc
actgagtttgattatgttattatcaacgacaagttggaagatgcgcttaatgatctgatc
tgcatagtcagagctgagcacttaaagaaagcccggcagctgataaaatatcatgaatta
atcgcccaattgtcataa

DBGET integrated database retrieval system