KEGG   Nitrosomonas sp. Is79A3: Nit79A3_2618Help
Entry
Nit79A3_2618      CDS       T01569                                 

Definition
(GenBank) fatty acid desaturase
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
nii  Nitrosomonas sp. Is79A3
Pathway
nii01040  Biosynthesis of unsaturated fatty acids
nii01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:nii00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Nit79A3_2618
Enzymes [BR:nii01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     Nit79A3_2618
Lipid biosynthesis proteins [BR:nii01004]
 Desaturase
  First
   Nit79A3_2618
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FA_desaturase DDE_Tnp_ISL3 HTH_28 RNase_HII HTH_Tnp_1
Motif
Other DBs
NCBI-ProteinID: AEJ02385
UniProt: F8GGB1
Position
complement(2801239..2802429)
Genome map
AA seq 396 aa AA seqDB search
MISDFLTLISGVIDMPWWGYVVVTLVFTHITIAGITIYLHRHSAHRALELHAIPSHFFRF
WLWLTTGMVTKQWTAVHRKHHAKCETKDDPHSPVIVGIAKVLSEGSELYRTEARNEETLK
RYGYGTPDDWIERNIYTKHSAKGVALMLIINVILFGPIGITMWAIQMMWAPIFAAGIING
VGHYWGYRNFQAEDASRNIVPWGILIGGEELHNNHHAYATSARLSNKWYEFDIGWMYIRI
LEMIGLAKVKKVAPKLRFDKEKTQCDSDTLQAVISHRYEVLAKYTKSLKETFAKEMVHLK
EATAQYGVDNSTLKRWILADSKTLQEHEREKLSQVLSNAKTLDKVYTMREELAEIWQRST
ATTEELVKQLEDWCRRAEESGIEVLQAFSQRLRCYA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgatttctgattttcttactttaatctctggtgtgattgatatgccttggtggggctat
gtcgtcgttaccttggtttttacgcatattacaattgcgggtattacaatttatcttcac
cgccattcagcgcatagagcgttggaattgcatgcgataccaagtcattttttccgtttc
tggttgtggttaactactgggatggttacaaagcaatggacagcggttcatcgcaagcac
catgcaaaatgtgaaaccaaggatgatccgcatagtcctgtaatcgttggtatcgcgaaa
gtgttaagcgaaggctcggaactttatagaacagaggcacgaaatgaggagaccctgaaa
agatatggatatggcacgccggatgattggatagaacgtaatatttataccaaacacagt
gcaaaaggtgtcgcattaatgctgattattaatgtaattctgtttggcccaattggtatt
actatgtgggcgatacaaatgatgtgggctccgatttttgctgcaggtattatcaacggt
gttggtcattattggggataccggaattttcaagcggaagatgccagcagaaatatcgtt
ccatggggtattttgattggtggtgaagaattacataacaatcaccatgcttatgcaaca
tcagcgcgattatccaataaatggtacgagtttgatatcgggtggatgtatatacgtatt
ttggagatgatagggcttgcaaaggtcaagaaagttgcgcctaagttacgtttcgataag
gaaaagacccagtgcgattcggatacattgcaagcagtcatctctcatcgttatgaggtt
cttgctaaatatacgaaatcgttgaaagaaacttttgcaaaagagatggttcacttgaaa
gaagcaactgcgcaatatggtgtggataattctactctgaagcgttggattctggctgat
tcaaaaactctgcaagagcatgagcgtgagaagctaagtcaagtgcttagtaatgctaag
acactcgataaagtttataccatgcgcgaggaattagctgaaatctggcaacgttctact
gcgacaactgaagagttggtcaagcagctggaagattggtgccgtcgtgcagaggaaagt
ggtattgaagtgctgcaagctttttctcagcgattacgttgctatgcataa

DBGET integrated database retrieval system