KEGG   Nitrosomonas sp. Is79A3: Nit79A3_2790Help
Entry
Nit79A3_2790      CDS       T01569                                 

Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
nii  Nitrosomonas sp. Is79A3
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:nii00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2958396..2959361)
Genome map
AA seq 321 aa AA seqDB search
MRRDKFSRRLMQETHLRIDDLIYPVFVLDGKKRIENVKSMPGVVRQSVDILMTKAENCLQ
LGIPALAIFPVIDTELKNLTASEAYNPDGLVPRAVMQLKKNFPELGVITDVALDPYTSHG
QDGLIDQHGYVLNDETVDVLCQQALVHAQAGANIVAPSDMMDGRIAAIRNSLDSQQFIHT
RILAYSAKYASSFYGPFRDAVGSATNLGASNKYTYQMDPSNSDEALWEVGADLNEGADMV
MIKPGMPYLDIVRRVKDHFGAPTFVYQVSGEYAMLKASAINGWLNEEACVLESLLAFKRA
GADGILTYYAVEAANWLRKSL
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgtgataaattttctcggcgtcttatgcaagaaactcaccttcgaatcgatgat
ctgatttatccagtttttgtattggatggaaaaaaacgtattgagaatgtcaagtctatg
cctggcgttgtaaggcagagtgttgatattttaatgactaaagctgaaaattgtttgcaa
ctaggtattccagcgcttgctatttttccggttattgatactgaacttaagaacctcacg
gcgagcgaagcatataatcccgatgggttggtacctagagcggtcatgcaattaaaaaag
aattttcctgagttaggagtgattacagatgtagcgctggatccatatacaagtcatggt
caagatggtttgattgatcaacatggctacgtactgaatgatgaaacagtagatgttctc
tgtcagcaagcattggtacatgcgcaagctggtgctaatattgtagcgccatccgatatg
atggacggacgcattgcggcaatccgtaatagtttggatagtcagcagtttattcataca
cgaatattggcttattcagctaaatatgcttcaagtttttatgggccatttcgagatgct
gtcggttcggcgacaaacctcggggctagtaataaatatacatatcaaatggatccgtca
aattcagatgaagcactttgggaagttggagcagatttgaacgaaggtgctgacatggta
atgattaaacctgggatgccctatttggacattgttcgtcgggtgaaagatcattttggc
gcaccgacctttgtatatcaggttagtggcgagtatgcaatgctcaaagcttctgcaatt
aacggatggttaaatgaagaggcctgtgtgcttgaatctttgcttgcttttaaacgcgca
ggcgcggatgggattttaacttattatgcggtagaagcagcaaattggttgagaaagagt
ctataa

DBGET integrated database retrieval system