KEGG   Nitrosomonas sp. Is79A3: Nit79A3_2909Help
Entry
Nit79A3_2909      CDS       T01569                                 

Definition
isochorismatase hydrolase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
nii  Nitrosomonas sp. Is79A3
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nii00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Nit79A3_2909
Enzymes [BR:nii01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     Nit79A3_2909
    3.5.1.-  
     Nit79A3_2909
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3070787..3071371
Genome map
AA seq 194 aa AA seqDB search
MKIAPASGDALIVVDMQNDFLPGGNLAVAGGNEIIPQLNRYLAHFAAHQLPVFATRDWHP
LSHCSFQSQGGPWPPHCIAGSDGAAFHPGLKLPANAHIISKATSPETDAYSGFTGTQFNA
LLQSLHIQRVFVGGIATEYCVLNTVKDALRLQYTTLILEDAVRAINQQPGDGQRALNEMI
RLGARPVHYEDLMP
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaattgcgcctgcttcaggagacgcgttgattgtggttgatatgcaaaatgatttt
ttgccgggcggtaatctcgcggttgcgggaggaaatgaaatcatcccgcagttgaatcgc
taccttgcgcattttgctgcacatcaattgccggtcttcgcaacacgtgactggcacccc
ttgtcgcattgttcctttcaatcgcaagggggtccatggccgccacactgcattgccggt
tcagacggcgcggcatttcatcccggccttaaattacccgccaatgctcacatcatttcc
aaagcaacttcaccggaaaccgatgcatattctggctttaccggaacgcagttcaatgcg
ctattacaatcactccatattcagcgggtttttgtgggcggcatcgcaaccgaatactgt
gtgctcaacaccgtgaaggatgccctgcgactccagtacacaactcttatactcgaggac
gcggtgcgcgcaatcaatcagcagcccggagacggccagcgcgcgcttaacgaaatgatc
cggctgggcgccagaccggtccattatgaggatcttatgccatga

DBGET integrated database retrieval system