KEGG   Nitrosomonas sp. Is79A3: Nit79A3_2935Help
Entry
Nit79A3_2935      CDS       T01569                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
nii  Nitrosomonas sp. Is79A3
Pathway
nii00010  Glycolysis / Gluconeogenesis
nii00051  Fructose and mannose metabolism
nii00562  Inositol phosphate metabolism
nii00710  Carbon fixation in photosynthetic organisms
nii01100  Metabolic pathways
nii01110  Biosynthesis of secondary metabolites
nii01120  Microbial metabolism in diverse environments
nii01130  Biosynthesis of antibiotics
nii01200  Carbon metabolism
nii01230  Biosynthesis of amino acids
Module
nii_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:nii00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nit79A3_2935
   00051 Fructose and mannose metabolism
    Nit79A3_2935
   00562 Inositol phosphate metabolism
    Nit79A3_2935
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Nit79A3_2935
Enzymes [BR:nii01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Nit79A3_2935
Exosome [BR:nii04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Nit79A3_2935
  Exosomal proteins of bladder cancer cells
   Nit79A3_2935
  Exosomal proteins of melanoma cells
   Nit79A3_2935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM DUF4989
Motif
Other DBs
NCBI-ProteinID: AEJ02686
UniProt: F8GIT9
Position
complement(3100568..3101323)
Genome map
AA seq 251 aa AA seqDB search
MRKKMVAGNWKMHGNLVENKQLLDAIVTGLNGLYKVNFFVCVPYPYLPSVQSILQNTNIA
WGAQNLSQFERGAYTGEISASMLNDFECRYVIVGHSERRSLFGEDSQIVAEKYQAAQRAG
ITPILCVGESLEQREAGTTEQVIEEQLATVIKLAGVESLAKAIVAYEPVWAIGTGRTASP
EQAQDVHSFIREGIAKQNVNIAKSLTILYGGSVKASNASALFDMSDIDGGLIGGASLVAN
DFVAICRALHQ
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaaaaagatggtggctggtaactggaagatgcacggtaatttggttgaaaataaa
cagctactcgatgcgattgttacgggcttgaatggattatacaaggttaatttttttgtt
tgtgtgccttatccctatctaccgtcggtacaaagcatattacagaatacgaacatagct
tggggtgctcaaaatttaagtcagtttgaaagaggcgcatatacaggagagatatcggct
tccatgttgaatgattttgaatgccgctatgtaattgtaggacactcggaaagaaggtca
ttatttggtgaagattctcaaatcgtcgctgaaaaatatcaagcagcccaacgggctggt
ataactcctatcctatgtgtaggggaatcacttgaacagcgtgaggcgggtacaacagag
caagttattgaagagcagttagcaacggttatcaaattggcaggagtcgaatcgctagct
aaggcgattgtcgcttatgagccagtatgggctatcggtacgggtcgaacagcatcgccg
gagcaagctcaagatgtgcattcttttataagagaaggtatagctaagcaaaatgtaaat
atagccaaaagcttaactattctatatggcggaagtgtcaaagcaagcaatgcatcagcg
ctatttgatatgtctgatattgatggtggtttaattggtggtgcatcactggttgcaaat
gattttgttgcgatatgtcgcgctttacatcaataa

DBGET integrated database retrieval system