KEGG   Nitrosomonas sp. Is79A3: Nit79A3_3003Help
Entry
Nit79A3_3003      CDS       T01569                                 

Definition
Succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
nii  Nitrosomonas sp. Is79A3
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:nii00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Nit79A3_3003
  Amino acid metabolism
   00300 Lysine biosynthesis
    Nit79A3_3003
Enzymes [BR:nii01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Nit79A3_3003
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3174463..3175665
Genome map
AA seq 400 aa AA seqDB search
MSNDTLALAQTLITRRSLTPADGGCQDILIERLEKLGFHIEKMRFGEVDNLWARRGNTAP
VLCFAGHTDVVPTGPLEQWDSDPFTPAIRDGKLYGRGAADMKSSLAAFITAIEAFVAQHA
NHQGSIALLITSDEEGIAIDGTVKVVEALKARGELMDYCIVGEPTCTEKLGDTLKNGRRG
SLSGNLTIKGIQGHIAYPHLAKNPIHLAAPAIAELAQTEWDQGNEYFPPTTWHISNIHGG
TGATNVIPGTLNLLFNFRFSTASTVESLKARVHEILDRHGFDYELEWELSGKPFLTPKGE
LANAMSSAITQVTTLEPQLSTSGGTSDGRFIADICPQVIEFGPLNATIHKLNEYVAVDDI
EQLSKIYQLTLENLLAIKNETAHANSDSFMDKLKKFFSFG
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgtccaatgacacattggccctcgcgcagacactgattacccgccgctcactgacacct
gccgatggcggttgtcaggacattttaatcgagcgtctggaaaaactcggcttccatatt
gaaaaaatgcgtttcggcgaagtcgataatctttgggcgcgccgtggcaatacggctccg
gtgctctgcttcgcgggacataccgatgtggtgcccaccggcccgctggaacaatgggac
agcgatccgtttacccccgccatccgtgatggcaaactctatggacgcggcgctgccgac
atgaaatcttcgctcgcagcctttatcaccgccatcgaagcttttgtcgcacaacatgcc
aatcatcaaggatcgattgcactgttgatcacttccgacgaagaaggcatcgcaatcgac
ggcacggtcaaagtggttgaagcgctgaaagcacgcggcgaactaatggactactgtatt
gtgggtgaacccacttgtactgaaaagctgggagataccctcaaaaatggccgccgcggt
tccttatccggcaatctgacgattaaaggcatacaaggccatattgcttatccgcatctg
gcgaaaaacccgatccatctcgccgcacctgcgattgcggaattggcgcaaaccgaatgg
gatcagggcaatgaatatttcccgccaacgacctggcatatctcgaatattcacggcggc
acaggcgccaccaacgtcatccccggcacactgaatttattattcaatttccgcttctca
accgccagcaccgtcgaatcgctcaaagcccgcgtgcatgaaattcttgaccggcatggc
tttgactatgaattagagtgggaactctcaggaaaaccttttctcacgcccaaaggtgaa
ttagccaacgccatgagcagcgccattacccaagtcaccaccctagaaccgcagctttca
acttccggcggcacttccgatggccggtttatcgcggacatctgcccgcaggtcatcgaa
tttggcccgctcaatgcaacgatacacaaactgaatgagtatgttgcagtcgatgacatc
gagcaattgtcgaaaatttatcagcttaccctggaaaatttattggccataaaaaatgaa
acagcccacgcaaattcagacagtttcatggataaattgaagaaatttttttcttttgga
tga

DBGET integrated database retrieval system