KEGG   Nitrosomonas sp. Is79A3: Nit79A3_3013Help
Entry
Nit79A3_3013      CDS       T01569                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
nii  Nitrosomonas sp. Is79A3
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:nii00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Nit79A3_3013
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nit79A3_3013
   00052 Galactose metabolism
    Nit79A3_3013
   00500 Starch and sucrose metabolism
    Nit79A3_3013
   00520 Amino sugar and nucleotide sugar metabolism
    Nit79A3_3013
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Nit79A3_3013
   00524 Butirosin and neomycin biosynthesis
    Nit79A3_3013
Enzymes [BR:nii01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Nit79A3_3013
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3183324..3184328
Genome map
AA seq 334 aa AA seqDB search
MTLNKQLIYGDIGGTKTILQLAEIRDGEIHQQFTHRYDSAAFVTFSDMLRDFLNRTETTN
HPVAACFAIAGPIVAQQTKVTNLPWQISSTGISAEFSIPVVKLINDFEAAALAIESLSPN
DLITLQTGQSHAQAMRVVLGAGTGMGVAWLTWLEGRYFALPTEAGHMDFAPVNELQIHLL
KALHDKFGHVSVERLLSGSGLTNIFNFLQMNAAIASDLAPVILEEDSGATITALAQTRKH
PIAIKSLDLFAEIYGVYAGNLALAGLCRGGVYIAGGIAPRIINILSSGGFMRAFRDKGRF
SALMNEIPVHVITNTEISLLGAKQEAHNLLNSQD
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgactttgaacaaacagcttatttatggcgacattggtggcaccaaaaccattctgcaa
ttggctgaaataagagacggagaaatccatcagcaattcacacatcgttatgacagcgcc
gcctttgtaactttctctgacatgctgagagattttctgaatcggaccgaaacaacgaat
catccggtagcagcctgctttgcaatcgcaggacctatcgttgcccaacaaacaaaagta
accaatttaccctggcaaataagtagcacgggcatttcggctgaattttctattcccgtt
gtcaagctcatcaatgattttgaagcggcggcattggcgattgaaagcctgtcacccaac
gatttgatcacacttcaaacagggcaaagccatgcacaagcgatgcgtgtcgtactgggt
gcgggcacagggatgggcgtggcctggcttacctggctggaaggccgctatttcgcattg
ccgactgaggcaggtcatatggattttgcaccggtcaatgaattacaaatccacttgctc
aaggcattacatgataaattcggccatgtatcggtagaacgtttgctatccggatccgga
ttaaccaatatttttaatttcctgcaaatgaatgcagcgatagcttcagatttagcaccg
gttattcttgaggaagacagcggcgccaccataaccgcactggcccagacccgcaaacat
ccgatcgcaatcaaatcattggatttatttgctgagatttatggggtctacgcgggtaat
ctggcgctggctggattatgccgcggcggcgtatacatagcaggcggcattgcccctcgg
attattaatatattaagctcgggcggctttatgcgcgcatttcgagacaaaggacgattt
tctgcattgatgaatgaaattcccgtgcatgtcataacaaatactgaaatcagcttgctg
ggtgccaaacaagaggcacataatctgctcaatagtcaggattga

DBGET integrated database retrieval system