KEGG   Nitrosomonas sp. Is79A3: Nit79A3_3040Help
Entry
Nit79A3_3040      CDS       T01569                                 

Definition
1,4-alpha-glucan branching enzyme
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
nii  Nitrosomonas sp. Is79A3
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nii00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Nit79A3_3040
Enzymes [BR:nii01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Nit79A3_3040
Exosome [BR:nii04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Nit79A3_3040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3219657..3221864)
Genome map
AA seq 735 aa AA seqDB search
MITLHKTNSLQNALLKAQLHDPFAYLGLHKEHGQTLVRVFRPYDVNVWIKTAIGFEPMQR
IHPHGVFEWRGESPPDMPYRLRIEEKGAKHTVYETYDPYAFPLQISDHDLYLFNEGKLRQ
AYRMLGAQRVRNADVDGMRFSVWAPNAGRVSVVGDFNRWDGRIHPMAVHHASGVWELFIP
GLLPDSLYKYEIRNRDSGEIVLKTDPYANRYELRPNTAARTPATSAYDWCDAAWIAKRNN
WDWLHAPLNILEIHAGSWKRHPDGRFYTYRELAQHLLPYVQEMGYTHIELMPVSEHPLDE
SWGYQTTGYFAVTSRYGSPDDFRFFVDACHQANIGVILDWVPAHFPQDTFALARFDGTAL
YEHEDPRLGFHQDWGTYIFNYGRNEVKSFLISSAHYWLSEFHLDGLRVDAVASMLYLDYS
RKEGEWLPNKYGGRENLEAIDFLRELNIMVHEEFPGALTLAEESTAWPAVSRPTYLGGLG
FSMKWNMGWMHDTLSYMQQDPVHRRYHHDKLTFSQLYAYTENFVLPFSHDEVVHGKGSLF
NKMPGDAWQKFANVRLLFVFQTTWPGKKLNFMGNEFAQKQEWRVSHELDWPLLQQQQHAG
IQAALRDLNQCYKNTPALHQLDFAAEGFSWIDCQDADQSVISYLRRAKDGTFVLVILNFT
PVPRSAYRIGVPASGIYREIFNSDSTYYGGSNLGNLGNIASVPMPWMGFSDSIAITLPPL
AGVVFSLQKLSDTEV
NT seq 2208 nt NT seq  +upstreamnt  +downstreamnt
gtgatcaccttgcataaaaccaattcattgcagaacgcattgctgaaggctcagctacac
gatccatttgcgtatcttgggctgcacaaagagcacggacaaactttggtgcgcgtattc
cgtccctatgacgtgaatgtgtggatcaagacagccatcggttttgagccgatgcaacgt
attcatccgcatggggttttcgagtggcgcggggaatcaccgcctgatatgccgtatcgg
ttgcggatcgaagaaaaaggggcaaagcataccgtctatgaaacgtatgatccgtatgct
tttccactgcaaatttccgatcatgatttgtatctgttcaatgaaggtaagttgcggcag
gcttaccggatgctcggcgcgcagcgggtcaggaatgccgatgtggacggcatgcgcttt
tcggtatgggcaccgaacgccgggcgtgtcagcgtagtcggtgattttaatcgctgggat
gggcgcattcatccgatggcggtacaccacgccagcggtgtctgggagctgtttattccg
ggactgttgccggattcactctacaaatatgagatccgcaatcgcgatagcggggaaatt
gttctcaagacggatccttatgctaatcgctatgaactccgtcccaacacggcggcacgg
acgcctgccacaagtgcctatgactggtgcgatgcagcgtggatagcgaagcgcaataat
tgggattggctgcatgcgccattaaatattcttgagattcacgccggatcgtggaagcgg
catccggatggccgtttttacacttaccgggaattggcgcagcacctgttgccttatgtg
caggaaatgggctatacccatatcgaattgatgcccgtttcagagcatccgctggatgaa
tcgtggggctaccaaaccaccggctattttgcggtcaccagccgctacggttcacccgat
gatttccggttttttgtcgatgcctgccaccaggcaaatatcggtgtaatccttgattgg
gtgcccgcgcatttcccgcaagatacttttgcgctggcacgctttgacggcacggcattg
tatgaacatgaagacccgcgccttggatttcaccaggattggggtacttatatctttaat
tatggccgcaacgaggtcaaatcattcctgatatccagcgcgcattactggctatccgaa
tttcatctggacggcttgcgtgtcgacgcagtggcttccatgctgtatctggattactcg
cgcaaagaaggcgaatggctgccgaataaatatggcggcagggagaatctggaagcgatc
gattttctgcgcgagctgaatattatggtgcacgaggagtttcccggcgcgttgaccctg
gcggaggaatccaccgcttggccggccgtatcgcgcccaacctatctcggcgggctgggg
ttttcgatgaaatggaatatgggctggatgcacgacacgctgtcctatatgcaacaagac
cccgtccaccggcgctatcaccacgataagctgacgttcagccaactgtatgcgtatacg
gaaaactttgtattgccgttctcacatgatgaagtggtgcatggaaaaggctctctcttc
aacaaaatgcccggcgatgcctggcaaaaatttgccaatgtacgcctgttgtttgtcttc
cagacgacttggccgggcaaaaagctcaatttcatgggcaatgaatttgcccagaaacag
gaatggcgcgtgagccatgagctggattggcccttgctgcaacaacaacagcacgccgga
attcaggctgcattgcgtgatttgaatcaatgttataaaaacacccccgccttgcatcaa
ctcgattttgctgccgaaggttttagctggatcgactgccaggacgccgatcaatccgtc
atcagctacctgcggcgtgccaaagacggcacatttgtattggtgattctcaatttcacc
ccggttccgcgcagcgcttatcgtatcggtgttcccgccagcggtatttaccgggaaatc
tttaacagcgattccacttattacggtggcagcaacctcggcaatttaggcaatattgcc
agcgtaccgatgccctggatgggattttctgactcgattgcgattacgttgccgccgttg
gcgggagttgttttttctttacaaaaattatccgatactgaagtttaa

DBGET integrated database retrieval system