KEGG   Nitrosomonas sp. Is79A3: Nit79A3_3102Help
Entry
Nit79A3_3102      CDS       T01569                                 

Definition
indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
nii  Nitrosomonas sp. Is79A3
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:nii01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:nii00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3281915..3282751
Genome map
AA seq 278 aa AA seqDB search
MPDILKKILAVKKQEIMAATALKPYPLLLQEARSVSPPRDFVAAIRNKINVGQSAVIAEI
KQASPSKGILRGCSSDTNAQSFEFLPAEIAKTYAQHGAACLSVLTDKQFFMGSSEYLQEA
RAACTLPVLRKDFILEDYQVTEARAMNADCILLIVSAFLLENIEPVMRMLKLEELANSLG
MAVLIEVHDANELEMALQLNTPLIGINNRNLRTFETSLNTTLELLNQIPSSKIVVTESGI
HSPADVALMRSQHVNAFLVGEAFMRAEDPGIELKRLFF
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgcccgatatcttaaagaaaatccttgcagtaaaaaaacaagaaattatggctgccacg
gcattaaagccctatccattattactccaagaagcccgatccgtatccccaccgcgcgat
ttcgttgcagcaattcgtaacaaaatcaatgtagggcaatccgctgttattgctgaaatc
aaacaagccagtcccagcaaagggatattacgcggatgctcctctgacaccaatgcacaa
tcgtttgaatttctgcctgccgagatagccaaaacttatgcgcaacatggtgcagcttgt
ctgtcagtattgactgataaacaattttttatgggaagctctgaatatttgcaagaggcg
cgcgcagcctgcacgcttcccgttctacgcaaagatttcattcttgaggattatcaggtt
actgaagcgcgcgctatgaatgcggattgtattttgctgatagtcagtgcttttttgcta
gaaaacattgaaccggtaatgcgtatgctgaagcttgaagaactcgccaattcgcttgga
atggccgttctgattgaagttcatgatgcaaatgaattggagatggcactccagctcaat
acaccgttaatcgggatcaataaccgcaacttacggacttttgaaacctctttaaatacc
actctggaattattgaatcaaattccatccagcaaaatagtcgttacggaaagcggtata
catagtcctgccgatgttgcactgatgcgcagtcaacacgttaatgcatttcttgttggt
gaagctttcatgcgcgctgaagatccaggcattgaattaaaaaggttatttttctga

DBGET integrated database retrieval system