KEGG   Nitrosomonas sp. Is79A3: Nit79A3_3153Help
Entry
Nit79A3_3153      CDS       T01569                                 

Definition
carbohydrate kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
nii  Nitrosomonas sp. Is79A3
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nii00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Nit79A3_3153
Enzymes [BR:nii01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Nit79A3_3153
Exosome [BR:nii04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Nit79A3_3153
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3337330..3338736
Genome map
AA seq 468 aa AA seqDB search
MDHALTSAIALDLGTTSIKAALMDRQGNLQHIVTRSAPAIDSHNGHYESNALDYAVIAEQ
VLKECIAQTGNNLPLGLCSQRSSFLIWDKISGNPVTPLISWQDARGASCCDRLHASTDTI
HNLTGLRLTAYYFAPKLSFLLQENPAWREKLVQGEWLAGTLDTFLIWRWTHGQHFLTDAS
MAARTLLMDIHRQHWSDTLCQLFDIPCSILPQIKLSTGLNLSLPDFGLILQACVGDQSAA
LIASLTDSRTDALVNLGTGGFVIRSLAKNELAFDGYLQTLVYQNENQQAQFAVEGTLNSI
AAALAPYSVKDCRIENLADNDIFCLAESSGLGAPYFRQDWGVYFSQSISALTTQQITVLM
LEAIIFRVARILEDFHHHSPLTQVYLSGGLSELPCLQQGIAQCVPFAVFHLQQKEASLQG
AALLASRLKINCRQQAKQIAINCGNNALSEKFQHWKNWLDGLLATHKN
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atggatcacgcactgacctcagcaattgcccttgatctgggaacgacatccattaaagcc
gctttaatggatcggcagggaaacctccagcatatcgtcactcgctctgcacctgccatt
gatagtcacaatggacactatgaaagtaacgcgcttgattatgctgtaattgccgagcag
gttctaaaagaatgtattgcacaaaccggcaacaatcttcctttagggttatgcagccag
cgttcatctttcctgatctgggacaaaatcagtggtaacccggtaacgcccctgatttct
tggcaagatgctcgaggggcaagttgctgtgatcgtctgcacgcatcaacagacaccatt
cataacctgaccggtttacgtttgaccgcttattattttgctcccaagctcagcttccta
ttgcaggaaaatccggcatggcgtgagaagcttgttcagggcgaatggctggcaggcacg
ctggatacttttctgatctggcgttggacgcacggtcaacattttctcaccgacgcgtcg
atggctgctcgcaccttgctgatggacatccaccggcaacactggtcagataccttgtgc
caactcttcgatattccatgctcgattctgccgcaaataaaactttcaaccggattgaat
ttatctttaccggattttggtttgattctacaagcctgtgtaggtgaccaatcggctgcg
ctgatcgccagcctgaccgatagccgaaccgacgctttggtcaatcttggcaccggtgga
tttgtgattcgttccctcgccaaaaacgagctggcgtttgatggttaccttcagacattg
gtttatcagaatgagaatcagcaggcgcaatttgccgttgaaggcacgctcaattccatc
gccgctgcactggcgccatattctgtgaaagattgccgcattgaaaatttggctgacaac
gacatcttctgcctggcggagtcgagtggtttaggcgcaccgtatttccgccaagactgg
ggagtttacttttctcaatctatctccgctttgaccacacaacaaattaccgtactgatg
ctcgaagctatcattttccgggtcgcacgcattctggaagatttccaccaccactcgccg
ctgactcaagtctacctatccggcggcctgtccgagttaccctgcctgcagcaaggtatc
gctcaatgcgtgccattcgcggtttttcatttacagcaaaaagaagcaagccttcagggt
gctgctttactcgcctccaggcttaaaataaactgccgccagcaagctaaacaaatagca
ataaactgcggaaacaacgcactatcagaaaaattccaacactggaaaaattggctggat
ggcttattggcaacgcacaaaaactaa

DBGET integrated database retrieval system