KEGG   Nitrosomonas sp. Is79A3: Nit79A3_3310Help
Entry
Nit79A3_3310      CDS       T01569                                 

Definition
alkaline phosphatase
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
nii  Nitrosomonas sp. Is79A3
Pathway
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:nii00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Nit79A3_3310
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Nit79A3_3310
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Nit79A3_3310
Enzymes [BR:nii01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Nit79A3_3310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3518754..3520181)
Genome map
AA seq 475 aa AA seqDB search
MKIQTPTIGPIIGYTTPNQTRIFLRGMDERQGTEFRRCFGVVRWRAAGLEAWSKPVFNKL
SPNFDMTGVFVLNGLSPSTKYEYQAGWFYADSELEMVQILDDRQLEWPDQIDGFQMSFRT
STSDTNVARSYVVGSCRYLLRLFGGAWFDDRGDKVFRTILQQIEQELHIDALLMIGDQIY
ADDLNFVSPDTRLDQFLERYRNVFSQENICKLMAQVPTYMILDDHEIEDNWPSKATKRDW
VTLYPHAIHAYQIYQCSHSPLFSAREDGRIDGTLSRFWYQFSDGCADWFVMDSRTERKLS
KSGERMISEVQMAGLLDWLNDGSGRVKFVVTSVPVFPDLSAESEDAKDKWGAFPMQRQAI
LEHIYNNKIRKVVFVSGDVHCSFTSQLTLESNPDFSIHSIISSSFFWPYPHMTKSDFLFG
EKLLGMDRHYTSELTSPVYTTDNFARIDADLSEVRVTFYERKGTQLGEAIRLPLK
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattcaaacgcccacgattgggccgatcatcggatacaccacgcccaatcaaacg
aggatattcttacgtggcatggatgagcgtcaaggcactgaattccggcgctgtttcggt
gtagtgagatggcgggcggcgggcttggaggcttggtccaaaccggtatttaacaagctt
tcgcctaactttgacatgaccggtgttttcgtgctgaatggattgtccccgagcacgaaa
tatgagtatcaggcaggttggttctatgctgattccgagttggagatggttcagattctc
gacgacagacaactcgaatggccggatcaaattgatggtttccaaatgagttttagaacc
agcacttcggacaccaatgttgcgcgatcctatgtggtcggctcctgccgttacctcttg
cgtctctttggcggcgcatggtttgacgatcgtggcgataaggtgtttcgtactattttg
caacaaatcgagcaagagttgcatatcgatgccttgctgatgatcggtgatcagatttac
gctgacgacctcaattttgtttcgccggacactcgtctggatcaatttctcgagcgctac
cgcaatgttttctcgcaagagaatatttgcaaactgatggcgcaagtgccaacctatatg
attcttgacgatcacgaaatagaggacaattggccctccaaagcgacgaagcgagattgg
gtaaccctgtatccccatgctattcacgcctatcaaatttatcagtgcagccatagtcca
cttttttctgcacgcgaagatggccgcattgacggtacgctttcgcgtttctggtaccaa
ttctcggacggatgcgcagattggttcgtaatggattcccgcactgagcgaaagctatcg
aaatctggcgagagaatgatcagcgaagtgcaaatggcgggattgttggactggcttaac
gacggctctggccgagttaagttcgttgttacgtctgttccggtttttccggacctgagt
gcggaaagtgaggatgccaaggacaaatggggcgccttcccgatgcaacggcaagccatc
cttgaacacatctataacaataagattcgcaaagtggtgttcgtgtcaggtgacgtccat
tgctccttcaccagccagcttaccctggaatcaaaccctgatttttctatccactcgatc
atctcttcatcgtttttctggccttatccgcatatgacaaagagcgatttcttgtttggt
gaaaaattacttggcatggatcggcactacacgagtgagttgacgtcaccggtatatact
acggataactttgcaagaatcgacgccgatttgtctgaagtccgggttactttttatgag
cggaaagggactcagctcggggaagcgattcgacttcctctgaaataa

DBGET integrated database retrieval system