KEGG   Nitrosomonas sp. Is79A3: Nit79A3_3475Help
Entry
Nit79A3_3475      CDS       T01569                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
nii  Nitrosomonas sp. Is79A3
Pathway
nii00900  Terpenoid backbone biosynthesis
nii01100  Metabolic pathways
nii01110  Biosynthesis of secondary metabolites
nii01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:nii00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Nit79A3_3475
Enzymes [BR:nii01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Nit79A3_3475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C NmrA Semialdhyde_dh Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: AEJ03197
UniProt: F8GDJ1
Position
3684409..3685596
Genome map
AA seq 395 aa AA seqDB search
MKTIRQITILGSTGSIGESTLDVIARHPDRFQAFALTANKNVEKMLSQCQRFQPRYAVML
DMKSAEQLTSAIQAARIDTEVLSGIESLERVASLPEVDAVMAAIVGAAGIRPTFAAARTG
KLVLLANKETLVMAGRIFIDLVKKHNATLLPIDSEHNAIYQSLPHHFNGNLAAAGISRIL
LTASGGPFRCAPLASLEKVTPEQACAHPNWDMGQKISVDSATMMNKGLEVIEAHWLFDAP
PDNIQVVIHPQSVIHSMVAYVDGSVIAQLGNPDMRTPIAHAMGYPDRIASGVSALDMFKV
AHLDFEEPDFERFPCLGLAYQALAAGGNMPAVLNAANEIAVESFLKVRMKFTAIPAMIEH
VMQTVQQEDMATLDDVLRTDALARDVAREWLANLQ
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccatccgccaaataactatactcggctccaccggcagcattggagagagcaca
ctggatgtcatagcacgccatcctgaccgttttcaggcatttgcgctaacagccaataaa
aatgttgaaaaaatgttgtcacaatgccaacgcttccagccgcgttatgcggtaatgctg
gatatgaaaagtgcggagcaattgaccagcgcaattcaagcagccaggatagatacggaa
gtattatctggtattgagtcattggaaagggtagcttctcttccagaagtggatgctgtg
atggcagcaattgttggagctgccggtatccgtccaacctttgcagcggctcgaaccgga
aaacttgtattgctcgccaataaagaaactctggttatggccgggcgtattttcatagat
ctggtaaaaaagcacaacgccacactgctgcccattgatagcgagcataatgcgatttat
caatctctgccgcatcatttcaatggtaacttggctgcggcaggcatcagccgcatactg
ctcactgcttcgggcggaccatttcgatgcgcgccgttagcatcgttagagaaagtgact
ccagaacaggcttgtgcgcatccgaattgggatatggggcaaaaaatttctgttgattct
gccaccatgatgaataaaggattggaagtaattgaagcgcattggttgtttgacgcacct
ccggacaatattcaggttgtaattcatccccaaagtgtaatccactcgatggttgcctat
gtcgatggttcagtcatagcgcaattgggcaaccctgatatgcgtacgccgattgcgcac
gcgatgggttatcccgatcggatagcaagcggagtatccgctttagatatgttcaaagtg
gcgcatcttgattttgaagaacctgattttgaaagattcccatgcctgggattagcctac
caagcgcttgccgcgggcgggaatatgcctgcagttctcaatgccgcaaatgagattgct
gtagaatcctttcttaaagtgcgcatgaaatttacagctatcccggctatgattgaacat
gttatgcaaacagtacaacaagaagatatggcaacactggatgatgtattgagaacagat
gcattggctcgtgacgttgcgcgagagtggcttgcaaatctgcagtaa

DBGET integrated database retrieval system