KEGG   Nitrosomonas sp. Is79A3: Nit79A3_3486Help
Entry
Nit79A3_3486      CDS       T01569                                 

Definition
Di-heme cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
nii  Nitrosomonas sp. Is79A3
Brite
Enzymes [BR:nii01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Nit79A3_3486
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3697210..3698262)
Genome map
AA seq 350 aa AA seqDB search
MKIFLFLAFVLSSYSYAQTSHDHQEDTKKADHHGGMHDGDHHGGMGGMHGGHHKLDQTTL
KQFFEPLPASIIDEKKNAALIKLGKKLYLDPRLSINDQISCNSCHRLDNFGVDSQPTSPG
HEGKRGGRNSPTTMNAALHIAQFWDGRAKDVEEQALGPILNPIEMGMPNEAAVVSKLKKI
EEYKALFAEAFKDEKDPFQYKNIGKAIGAFERTLLTPSRFDDYLKGDESALNDNEKRGLQ
KFIHMGCATCHNGVALGGNSYKRIGVVKPYETKDMGRFEITGIETDKKVFKVPSLRNITK
TAPYFHDGSVATLDKAIEEMAEHQLGREVGPGFINDVKAFLGSLTSKGKE
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatattcttattcttagcgtttgtattgagttcctatagttatgctcaaactagt
catgatcatcaagaggacacgaagaaggctgatcaccatggtggaatgcacgatggcgat
catcacggtggaatgggcggcatgcatggcggtcatcacaaactggaccaaaccacttta
aaacaattttttgaaccgttacctgcatcaattattgatgagaaaaagaatgcagctttg
atcaagcttggcaagaaactgtatctggatccccggctttcgatcaatgatcagatttcc
tgtaattcttgtcatcggctggataatttcggcgtagacagtcagccaacttcaccaggc
catgaaggaaaacgcggcggcagaaattcgccaaccacgatgaatgcggcgctgcatatc
gcacaattctgggacggacgagcaaaagatgtggaagaacaagcacttggtcccattttg
aaccccatcgaaatgggtatgccgaatgaagcagctgttgtcagcaagttgaaaaaaata
gaggaatataaggctctctttgcagaagcttttaaagatgaaaaagatccattccaatac
aaaaatataggtaaggcaattggtgcttttgagcgtacgctgctaacgccttcccggttt
gatgactatctcaaaggcgacgagagcgctctgaatgacaatgagaaaagaggcctgcag
aaatttatccacatgggatgcgccacttgccacaatggcgtagcgcttggcgggaattca
tataaaaggataggcgttgttaaaccttatgaaaccaaagatatggggcgatttgaaata
accgggatcgaaactgacaagaaagtgttcaaggtgccaagcctgagaaatattaccaaa
acagccccgtatttccatgacggctcagttgctacattggataaagcaatcgaagaaatg
gctgagcaccaactgggccgggaagttggccctggatttattaacgatgttaaagcattt
ctaggttccttaaccagtaagggtaaggaataa

DBGET integrated database retrieval system