KEGG   Nitrosomonas sp. Is79A3: Nit79A3_3512Help
Entry
Nit79A3_3512      CDS       T01569                                 

Definition
(RefSeq) 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
nii  Nitrosomonas sp. Is79A3
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:nii00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Nit79A3_3512
   01230 Biosynthesis of amino acids
    Nit79A3_3512
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nit79A3_3512
  Energy metabolism
   00680 Methane metabolism
    Nit79A3_3512
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Nit79A3_3512
Enzymes [BR:nii01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Nit79A3_3512
Exosome [BR:nii04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Nit79A3_3512
  Exosomal proteins of melanoma cells
   Nit79A3_3512
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3724214..3724954)
Genome map
AA seq 246 aa AA seqDB search
MLRAITSPASAQKKVTQLVLLRHGQSIWNRDKIFTGWSDVPLSPKGEKEAEQAAYLLKQA
GFTFDLCFSSTLQRARTTSRIVLASMQLNEIPVHESWRLNERHYGALEGMARWQAIKKFG
IWPILGCQIKFDAAPPYLDSQDPRFPGNQPGYTGINKDELPLGESMQQTLARFQPYWKKT
IQPEIQQGRRILIVSHKNTLRTLMMLLDQLTPRQVMKLSLATGRPLVYELDQQYNAIRHY
YVDHLK
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgagccattacttcaccagcaagcgcgcagaaaaaggtcacgcaacttgtcctg
ctgcgccatggccaaagtatctggaatcgcgataagatttttaccggctggagtgatgtt
cctttgagtcccaagggtgaaaaagaagctgagcaggccgcttatttgctgaagcaggcg
ggctttacatttgatctgtgtttttcctctacattgcaacgcgcgagaaccacatcacgg
atcgttttggcttcaatgcagttaaatgaaataccggttcatgaaagctggcgattgaac
gaacgtcattatggcgcactggaaggcatggcgcgttggcaagccatcaagaaatttggt
atctggcccatcctaggctgccaaattaaatttgatgctgcacctccgtatctggattcc
caagatccacgattccctggaaatcaacccggctacaccggcattaataaagatgagctg
cctctgggggagagtatgcaacaaaccctcgcgcgctttcagccttactggaagaagacc
atccaaccggaaatacaacaagggaggcgaatactcatcgtttcccacaaaaataccctg
cgcacgttaatgatgctattggatcaactcacccccagacaggtcatgaaattatcactg
gccaccggccggcctttggtttacgaactggatcagcaatacaacgctattcggcattac
tacgtggaccatctcaaataa

DBGET integrated database retrieval system