KEGG   Nitrosomonas sp. Is79A3: Nit79A3_3543Help
Entry
Nit79A3_3543      CDS       T01569                                 

Definition
chemotaxis protein CheR (EC:2.1.1.80 3.1.1.61)
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
nii  Nitrosomonas sp. Is79A3
Pathway
Two-component system
Bacterial chemotaxis
Module
CheA-CheYBV (chemotaxis) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:nii00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Nit79A3_3543
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Nit79A3_3543
Enzymes [BR:nii01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     Nit79A3_3543
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Nit79A3_3543
Two-component system [BR:nii02022]
 CheA family
  CheA-CheYBV
   Nit79A3_3543
Bacterial motility proteins [BR:nii02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Nit79A3_3543
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3760204..3762801)
Genome map
AA seq 865 aa AA seqDB search
MVSLPDINQSANPPAKTRIVGIGASAGGLAALEQFMEQVPLESGLAYVVVQHLDPTQKAL
LAELLQRVTKLPVREAENRMRIEPDCVYVIPPNTELSVVDGVLNLEKPTEPRGLRLPINV
LFSSLARDQGERAIAVILSGMGSDGTLGLQAVRALGGLTVVQQPDSAQFDSMPRSAIAAE
CADIIAPPAELPARILAYTAQAPKLQEPGIAAEEVVQASSELPALPVNPLQSIFSLLRQQ
TRHDFSVYKPSTLHRRIERRMAIHGITTLALYAEYMQQNTQEIDLLFKELLIGVTSFFRD
PAVWQQLADFTLPELLARQTIEQKLRAWVVGCSTGEEAYSLAILFNEVVQRLSLRHDYTL
QIFATDLNPDAIATARRGLYPTAISADVSAERLARFFSAHDKYYRINKNIRDMVLFAQHD
VVLDPPFTKLNLLSCRNLMIYFDAALQRRLLPLFHYSLRPGGVLLLGSSETVGRFKQLFT
PIESRLRLYLRQDNASNTGPDLLVKSFPPLSKIKKELPVPHPTDTSQPAENLQTAADQVL
LQMYTPAAVVVNNAGDIVYISGRTGKYLEPAAGKVNWNFHAMVREGLRAPLADALKKAVT
ENEPVQLRGLQVQSAEGVQCVDVTVQAFRESSVLQGMMLIVFRDVVMPTPRRGRRKGKSA
VEASHEYELQQYQDEILKLREETHASNEELQSTNEELQSTNEELQSANEELTSSKEEMQS
MNEELQTINAELQNKLDALALAESDMKNLLNSTDIAILFLDQELNVRRYTEQASKIINVR
ESDIGRPLSDLTTILQYPALQDDVKETLRTLIFSEKQISAGDDRWFSVRIMPYRRLDNVI
DGAVITFVDISATKRLESKLCQDLD
NT seq 2598 nt NT seq  +upstreamnt  +downstreamnt
atggtctctctgcctgacatcaatcaatccgctaatccaccggcgaaaacgcgcatcgtc
ggcatcggtgcttcggccggaggtcttgcggcactggaacaatttatggagcaggtgccg
ctggagagtggcttggcctacgttgtggtgcagcatctcgatcctacgcaaaaagctttg
ttggctgagttacttcagcgtgtcaccaagctgccggtacgagaggctgaaaataggatg
cgcatcgagccggattgcgtgtatgtaatccctccgaacacggagcttagcgtagttgac
ggtgtgctgaatctggaaaagcccaccgagccacgcggcttgcggctgccaatcaacgtc
ttgttttcttccctggcgcgcgaccagggtgagcgtgcgattgcggtgattttgtccggt
atgggatcggacggcacactgggtttgcaggcggtcagggcattgggcggtctaaccgtt
gtacaacagcccgattcggcgcagttcgactcgatgcccaggagtgccatcgctgcggag
tgcgccgacattatcgcaccacctgcggagttaccagcgcgcattctggcctatactgcc
caggcacccaagctgcaggagccgggcatcgctgccgaggaagtggttcaagcatcttcg
gaactcccggctttgccggtgaatccactgcaaagcattttcagcttattacgccagcaa
actcggcacgatttttccgtgtacaaacccagcaccctgcatcgccgcatcgagcggcgc
atggctatccacgggatcaccacgctggcgctgtacgcagaatacatgcaacagaataca
caagagattgatttgctgttcaaggagttgctgatcggcgtaaccagcttttttcgtgac
cccgcagtctggcagcaattggcggatttcactttgccggaactgctggcgcggcagacc
atcgagcaaaagctgcgcgcttgggttgtcggctgctcaaccggggaggaggcctattca
ctggccatcctattcaacgaggtagtgcagcggctgtcactacgccacgattacacgctg
caaattttcgctacagatctgaacccggatgccattgccacggcacgccgcgggctatat
cccaccgcgatcagcgctgacgtgtcagcggaaagattggcgcgttttttcagcgcacat
gataaatattaccggatcaacaagaacatccgcgatatggtgttgtttgcgcagcacgat
gtggtgctcgatccgcctttcaccaagctcaacttgctttcttgccgcaatctgatgatc
tacttcgatgccgcgcttcagcgcaggttattgcccttgtttcactacagcctgcgtcca
ggcggcgtgctgcttttgggaagttcggagacagtcgggcgattcaaacagctgttcacc
ccgatcgagtcgagattgcggttatatttgcgtcaagacaacgcctccaacaccggcccg
gatctgttggtgaagtcgtttccacccctgtccaagattaaaaaggaacttccagtgccc
catcccaccgatacttcccaacctgctgagaatttacaaacggccgccgatcaggtgtta
ttgcagatgtatacgcctgctgccgtggtcgtcaataatgccggcgacatcgtctacatc
agcgggcgcaccggaaaatacctggaaccggccgccggtaaggtcaactggaacttccac
gccatggtgcgcgagggtttgcgcgcaccgcttgccgatgcattgaaaaaggctgtcacg
gaaaacgaaccggtacaattgcgcggtttgcaagtacaaagcgcggaaggtgttcagtgt
gtcgatgttaccgtgcaggcattccgcgaatcttccgttttgcaaggtatgatgctgatc
gtattccgcgatgtagtgatgcccacgccacggcgtgggcgacgcaagggaaaaagcgcg
gtggaggcatctcatgagtatgaattgcaacagtatcaggacgaaatcttgaagctgcgc
gaggagacgcatgcatcaaacgaagaattacaatcgaccaatgaagaattgcagtccacc
aacgaagagctgcaatcagccaacgaggagctaacctcttcgaaagaagaaatgcaatct
atgaacgaggagctgcaaacgatcaatgctgagctgcagaacaaactcgacgctctcgcg
ctcgccgagagcgacatgaaaaatctgctcaacagcactgatatcgcgatactgttcctt
gatcaagaattaaacgtgaggcgctataccgagcaggcatcgaagatcatcaatgtccgg
gaaagcgacattggccggccgctcagcgaccttaccaccatcttgcaatacccggctttg
caagacgatgtgaaagaaacgctgcgtactttaattttttccgaaaaacagatctccgcc
ggagatgaccgttggttttctgtgcgaattatgccttatcgaagactggacaatgtaatc
gacggcgccgtaatcacctttgtcgacatctctgcgacgaagcgattggaatcgaaactc
tgccaagatctggattaa

DBGET integrated database retrieval system