KEGG   Nitrosomonas sp. Is79A3: Nit79A3_3555Help
Entry
Nit79A3_3555      CDS       T01569                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
nii  Nitrosomonas sp. Is79A3
Brite
Enzymes [BR:nii01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Nit79A3_3555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3773451..3774104
Genome map
AA seq 217 aa AA seqDB search
MNLEQTRFNMVAQQIRTWSVLDDNVLDLLYKIKREEFVPAENRAMAFVDMEIPLGYGQVM
LTPKMEARIVQELHVKKTDKILEVGSGSGYLTALLADRGAHVYSVEIIPELKAMAENNLK
AHEITNVTVEQGDAARGWPKHEPYDVIVLTASTPVLPDAFQKSLYPGGRLFAIVGEDPVM
EALLITCVAPGEFTTTKLFETSTAPLINVLQPSRFTF
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgaatctcgaacaaactcggtttaatatggttgcccagcaaatccggacatggagtgta
ttggatgacaacgtactggatttactgtacaaaataaagcgtgaagaatttgttccagcc
gaaaatcgcgcaatggcttttgtggatatggaaattccgctgggttatggccaagtaatg
cttacccccaaaatggaagcgcgcatagtacaggaacttcatgttaagaaaacagacaaa
attctggaagtcggcagcggcagcgggtacttaacggcgctactggctgatagaggcgca
catgtttacagtgttgaaattattccagaactgaaagcaatggcagaaaataatcttaaa
gcgcatgaaattacgaatgtaactgtcgaacaaggtgatgctgcgcgcggatggccgaag
catgaaccttatgatgtgattgttttaaccgcatcgacacctgttttacccgatgctttt
cagaaaagtctgtatccgggcggacggttatttgcgattgtcggagaagatccggtcatg
gaagctttgctgatcacttgtgtagcgcctggcgaattcaccacaaccaagctgtttgaa
accagtacagcaccgctcatcaatgtactgcaaccgtcaaggtttaccttttga

DBGET integrated database retrieval system