KEGG   Nitrosomonas sp. Is79A3: Nit79A3_3559Help
Entry
Nit79A3_3559      CDS       T01569                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
nii  Nitrosomonas sp. Is79A3
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:nii00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Nit79A3_3559
Enzymes [BR:nii01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Nit79A3_3559
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3781252..3781746
Genome map
AA seq 164 aa AA seqDB search
MSKTPSQAFIALGSNLENPISQIQQAFDELKQLPGTRLISHSSLYKSAPVGRLDQPDFIN
AVALIETHLAPHELLNALLAIEHRHGRVRESLNAPRTLDLDILLYDALQYHDAGLTLPHP
RMWQRAFVLRPLIEIAPDCHIPGHGHIASLLTACNEQKLEQIKA
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaacaccgagccaggcttttattgctttgggcagtaatctggaaaatccgatt
tcccagatacagcaagcatttgatgaattaaaacaacttccaggtactcgcttaataagc
cattcttcgctgtataaaagtgctcccgttggacgattggatcagcccgattttatcaat
gcggtagcattgattgaaacgcatctggcaccgcatgagctgctcaacgcattgctggct
attgaacaccggcatgggcgcgtacgcgaatctttgaatgcgccgcgtactctggatctc
gatattctgctgtatgatgcgctgcagtatcatgatgcaggattgactttaccgcacccg
cgcatgtggcaacgcgcttttgtcttgaggccgctgatagaaatcgctccggattgtcac
attcctggtcacggccacattgcctcactgctaaccgcgtgcaatgaacaaaaactagaa
caaatcaaagcttga

DBGET integrated database retrieval system