KEGG   Candidatus Nitrosopumilus sediminis: NSED_00715Help
Entry
NSED_00715        CDS       T02303                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
nir  Candidatus Nitrosopumilus sediminis
Pathway
nir00340  Histidine metabolism
nir01100  Metabolic pathways
nir01110  Biosynthesis of secondary metabolites
nir01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nir00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    NSED_00715
Enzymes [BR:nir01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     NSED_00715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: AFS81955
UniProt: K0BAG6
Position
126555..127826
Genome map
AA seq 423 aa AA seqDB search
MRIIKITNVEKFAAKILPKQPQNNKTIVESILKDVKKNGDTAIKKYEKKFSKASIPSLRI
SKNEIKNAYSQVSKTELDALRLAKAKLGKTESTVKSLLKNTTINQDGIKITKKFIPIQSV
GCYIPGGLAKYPSSVIMSVVPAKIAGVKRIVVVSPPNSDGKIDPLTIVSADICGADEIYK
TGGVQSIAALSYGTKSIPKVDKIVGPGGAFVTAAKSLISDQTGIDMLAGPTELGIIADNS
ANPKFVALDLISQAEHSNDTFCYLITTSQKLAISVNKILSELIPKIQRGKITKFSLKNNG
FIGICKNNSDMIKLANILAPEHLQIMTKNPKAISSKITASGLVLIGNNTPSSASDYILGS
NHILPTNGFGKIRGPLSVLDFIKVNTQISSSKKSLSKISKHLQVLTKAEGLPNHYKAVRG
RLN
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgagaataatcaaaattactaatgtagaaaagtttgcagcaaaaattctcccaaaacag
cctcaaaataacaaaactatagttgaatcaatcctaaaagatgttaaaaaaaatggcgat
actgcaatcaaaaaatatgaaaaaaagttcagcaaggcaagcattccttcattacgcata
tccaaaaatgaaattaaaaatgcatactctcaagtatcaaagaccgaacttgatgcatta
agattagcaaaagccaagcttggaaaaacagaatcaactgttaaatcattactaaaaaat
accacaattaatcaagatggaataaaaatcacaaaaaaatttattcctattcaaagtgta
ggatgttatataccaggcggattagcaaaatatcccagttctgtaatcatgtctgtggtt
ccagctaaaattgctggagtcaaaagaattgtagttgtatctccgccaaactctgatgga
aaaattgatccattaactatcgtatctgctgatatttgtggagctgatgagatttacaaa
acaggaggtgtacaatcaattgcagcattatcttatggaacaaaatcaattccaaaagtc
gataaaattgtaggtcctggaggagcatttgtaacagcagcaaaatctttgattagtgat
caaactggaattgatatgcttgcaggtcctactgaattgggaataatagcagacaactcg
gcaaacccaaaatttgttgctttggatttaatttctcaagcagaacacagcaatgacaca
ttttgctatttgattactacatctcaaaaacttgcaatatctgtgaacaaaattctttct
gaattaattccaaaaatccagagaggaaaaatcacaaaattcagtcttaaaaataatgga
tttattggaatatgtaaaaacaattctgatatgataaaacttgcaaatattttggcccct
gaacacttgcaaataatgactaaaaacccaaaagccatatcttcaaaaattactgcatcg
ggtctggttttaattggaaacaacactccctcctcagcaagtgactacattttaggctca
aatcacattttgcctacaaacggatttggaaaaatcagaggcccactttcggtcttggac
tttatcaaggtaaatacacagatttcatcatcaaagaaatcattatcaaaaatatcaaaa
catctccaagtcttgacaaaagctgaaggattgcctaatcactataaagcagttagaggt
agattgaattga

DBGET integrated database retrieval system