KEGG   Candidatus Nitrosopumilus sp. AR2: NSED_00715Help
Entry
NSED_00715        CDS       T02303                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
nir  Candidatus Nitrosopumilus sp. AR2
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nir00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NSED_00715
  Amino acid metabolism
   00340 Histidine metabolism
    NSED_00715
Enzymes [BR:nir01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     NSED_00715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
126555..127826
Genome map
AA seq 423 aa AA seqDB search
MRIIKITNVEKFAAKILPKQPQNNKTIVESILKDVKKNGDTAIKKYEKKFSKASIPSLRI
SKNEIKNAYSQVSKTELDALRLAKAKLGKTESTVKSLLKNTTINQDGIKITKKFIPIQSV
GCYIPGGLAKYPSSVIMSVVPAKIAGVKRIVVVSPPNSDGKIDPLTIVSADICGADEIYK
TGGVQSIAALSYGTKSIPKVDKIVGPGGAFVTAAKSLISDQTGIDMLAGPTELGIIADNS
ANPKFVALDLISQAEHSNDTFCYLITTSQKLAISVNKILSELIPKIQRGKITKFSLKNNG
FIGICKNNSDMIKLANILAPEHLQIMTKNPKAISSKITASGLVLIGNNTPSSASDYILGS
NHILPTNGFGKIRGPLSVLDFIKVNTQISSSKKSLSKISKHLQVLTKAEGLPNHYKAVRG
RLN
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgagaataatcaaaattactaatgtagaaaagtttgcagcaaaaattctcccaaaacag
cctcaaaataacaaaactatagttgaatcaatcctaaaagatgttaaaaaaaatggcgat
actgcaatcaaaaaatatgaaaaaaagttcagcaaggcaagcattccttcattacgcata
tccaaaaatgaaattaaaaatgcatactctcaagtatcaaagaccgaacttgatgcatta
agattagcaaaagccaagcttggaaaaacagaatcaactgttaaatcattactaaaaaat
accacaattaatcaagatggaataaaaatcacaaaaaaatttattcctattcaaagtgta
ggatgttatataccaggcggattagcaaaatatcccagttctgtaatcatgtctgtggtt
ccagctaaaattgctggagtcaaaagaattgtagttgtatctccgccaaactctgatgga
aaaattgatccattaactatcgtatctgctgatatttgtggagctgatgagatttacaaa
acaggaggtgtacaatcaattgcagcattatcttatggaacaaaatcaattccaaaagtc
gataaaattgtaggtcctggaggagcatttgtaacagcagcaaaatctttgattagtgat
caaactggaattgatatgcttgcaggtcctactgaattgggaataatagcagacaactcg
gcaaacccaaaatttgttgctttggatttaatttctcaagcagaacacagcaatgacaca
ttttgctatttgattactacatctcaaaaacttgcaatatctgtgaacaaaattctttct
gaattaattccaaaaatccagagaggaaaaatcacaaaattcagtcttaaaaataatgga
tttattggaatatgtaaaaacaattctgatatgataaaacttgcaaatattttggcccct
gaacacttgcaaataatgactaaaaacccaaaagccatatcttcaaaaattactgcatcg
ggtctggttttaattggaaacaacactccctcctcagcaagtgactacattttaggctca
aatcacattttgcctacaaacggatttggaaaaatcagaggcccactttcggtcttggac
tttatcaaggtaaatacacagatttcatcatcaaagaaatcattatcaaaaatatcaaaa
catctccaagtcttgacaaaagctgaaggattgcctaatcactataaagcagttagaggt
agattgaattga

  All links  
No link information was found.   
DBGET integrated database retrieval system