KEGG   Candidatus Nitrosopumilus sediminis: NSED_00880Help
Entry
NSED_00880        CDS       T02303                                 

Definition
(GenBank) protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
nir  Candidatus Nitrosopumilus sediminis
Brite
Enzymes [BR:nir01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     NSED_00880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_31 Methyltr_RsmB-F RrnaAD Methyltransf_25 GCD14 MTS GidB PrmA Methyltransf_4 Methyltransf_11 Methyltransf_18 Met_10 Fibrillarin TehB Methyltransf_24 Methyltransf_23 Ubie_methyltran tRNA_U5-meth_tr Methyltransf_12 Methyltransf_32 CMAS
Motif
Other DBs
NCBI-ProteinID: AFS81988
UniProt: K0B788
Position
152531..153124
Genome map
AA seq 197 aa AA seqDB search
MKNQTISQPGVVTRMTEWLDVRDGQKILEIGTGSGWQSAILAYLVGKGDVYSVERHPELV
KFAQENLKKLNIDNVHVILGDGSVGYTDKSPYDRIIITAACSEIPLPLFDQLKENGLIIA
PVGDSSQSLILLQKTPKGIVEIKNQPKYVFVPLHGKFGKNNCFCITIKRILLRHNLLLIL
YLLTHLHLLHSLVILLL
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatcaaaccatttcccaacctggagttgttacaagaatgacagaatggttagat
gttagagatggacaaaaaattctagaaattggtacaggttcaggttggcaaagtgcaatt
cttgcttacttggtaggaaagggagatgtttattctgtcgaacgacatccagaacttgta
aaatttgcacaagaaaatctgaaaaaattaaacattgacaatgttcatgtaattttaggt
gatggcagtgttggatatactgacaaatcaccttacgatagaataataattactgcagca
tgttctgaaatccccttgccattgtttgatcaactaaaagaaaatgggctcataattgca
cctgttggtgattcatcacaatcattgattcttctgcaaaagacacccaaaggaattgtt
gagattaaaaatcaaccaaaatatgtttttgttccattacatggaaaatttggaaaaaat
aattgtttttgtatcactattaaacgaattttattgcgccataacctactactgattctg
tatctcctgacacatctccacttgttgcatagcttagtaattctccttttgtag

DBGET integrated database retrieval system