KEGG   Candidatus Nitrosopumilus sp. AR2: NSED_00945Help
Entry
NSED_00945        CDS       T02303                                 

Definition
phosphoglucosamine mutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
nir  Candidatus Nitrosopumilus sp. AR2
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:nir00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NSED_00945
   00030 Pentose phosphate pathway
    NSED_00945
   00051 Fructose and mannose metabolism
    NSED_00945
   00052 Galactose metabolism
    NSED_00945
   00500 Starch and sucrose metabolism
    NSED_00945
   00520 Amino sugar and nucleotide sugar metabolism
    NSED_00945
  Nucleotide metabolism
   00230 Purine metabolism
    NSED_00945
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    NSED_00945
Enzymes [BR:nir01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     NSED_00945
    5.4.2.8  phosphomannomutase
     NSED_00945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
162177..163538
Genome map
AA seq 453 aa AA seqDB search
MHSIVAKFFGTNGIRGVFDEDFTLEFVHDMTLAIGTYFEKGSVLIGYDGRESSPVICKVV
SSALNSIGIDCNVAGLVPTPCLEYAVKSLGYSGGIMITASHNPPQYNGIKPCAKDGVEIS
REDELIIEEIYLQKSWLKKPDSWGKTGTENRAIETYLQGIISHIDSKLVESKHFKVVLDL
GNGAQAVTAPNFCEILGCETFLVNPKIDGTFPGRGSEPTPQNLSELSKTVQENNADVGIA
FDGDGDRSIFCDNNGDILTGDKSALVLSQHILKKNPNSLVVTCLNSSSNIEVLAKKFNSK
VIRTKVGSVEVSRKMVPTGALIGFEENGGYMFGKHNQVRDGCMTLALMLDLLATSGKTLA
EEIDDLPPSFTTKDKVSCPAQKVPKLISALKEEFPNADTSDGIKITIDPRNWVMIRPSGT
EPIVRVYAEAESQEKLDTLMSEYLEKVSSTISR
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
ttgcacagtattgtggcgaaattttttggaacaaatggaattcgtggagtcttcgatgaa
gattttacattagaattcgttcatgatatgacacttgcaattggaacatattttgaaaaa
ggatctgtattgataggatatgatggacgagaatctagtcctgttatttgtaaagttgta
agttctgctttaaattcaataggaattgattgtaatgttgcaggacttgtaccaactcct
tgtttagaatatgcagtgaagagcttaggatattctggaggaataatgattacagcatcc
cacaatccaccacaatacaatggtatcaagccttgtgccaaagacggtgtagagatttca
cgtgaagatgaattaattattgaggaaatttatttacaaaaaagctggctcaaaaaacct
gattcatggggaaaaactggaactgaaaacagagcaattgaaacatatctacaaggaatt
atttcacatattgattctaaactagtagaatctaaacatttcaaagttgttttagattta
ggtaatggtgcacaagcagtaactgctcctaacttttgtgaaatacttggatgtgaaaca
tttttagtaaatcctaaaattgatgggacatttccaggacgtggatcagaaccaacgcca
caaaatctttctgaactttcaaaaactgtacaagaaaataatgcagatgtaggaattgca
tttgacggagatggagaccgaagtattttttgtgataacaatggtgatatcttgactgga
gataaatctgcactagtacttagccaacacattctaaagaaaaatccaaactctctagtt
gtaacttgtttgaattctagttctaacattgaagttttagctaaaaaatttaattccaaa
gttattagaaccaaagtaggaagcgttgaagtctcaagaaaaatggttccaactggggca
ctgattgggtttgaagaaaatggtggctacatgtttggaaaacacaatcaagtcagagat
ggctgtatgactttggcattgatgcttgacttgctagcaacatctggaaaaactcttgct
gaagagattgatgatctacctccttcttttactaccaaagacaaggtctcatgtcctgcc
caaaaagttccaaaactaatttctgctctaaaggaggaatttccaaacgctgacacttct
gatggaatcaaaataacaattgatcccagaaactgggtaatgattagacccagcggaaca
gaacctattgttagagtatatgcagaagctgaaagtcaggagaaattggatactttgatg
tctgaatatcttgaaaaagtcagctcaacaatttccagataa

DBGET integrated database retrieval system