KEGG   Candidatus Nitrosopumilus sp. AR2: NSED_02630Help
Entry
NSED_02630        CDS       T02303                                 

Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
nir  Candidatus Nitrosopumilus sp. AR2
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:nir00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    NSED_02630
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NSED_02630
  Lipid metabolism
   00071 Fatty acid degradation
    NSED_02630
  Amino acid metabolism
   00350 Tyrosine metabolism
    NSED_02630
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    NSED_02630
   00626 Naphthalene degradation
    NSED_02630
Enzymes [BR:nir01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     NSED_02630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
440371..441423
Genome map
AA seq 350 aa AA seqDB search
MKSARITGPNEPLTVSETETPKPQGTQVLVKVSSVGVCHSDLHLWEGGYDLGDGQFMKVT
DRGVKYPVTPGHEIVGTVEQIGDGVSNVSVGDAVLVYPWIGCGQCPACKVGNENLCDAPK
SMGVFQDGGYSDYSLIPDSKYLAKLDGVDPDAATSIACSGLTAYTAIKKANQNSPEFLVI
VGAGGLGLMGVQIASAITDAKIICVDLDDAKLETAKEMGADFTVNSKDPETIQKIMSICN
EKGADSVVDFVNAPPTVKTGLAVLRKRGNLVLVGLFGGSLEISLVTIPMKSIIIQGAYTG
NYNDMVELLDLARKGTINPVISKRYSLDEANNALEDLKARKILGRAVINP
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaaatctgctaggatcacaggcccaaatgagcctcttacagtatctgaaactgagact
cctaaaccccaaggtactcaagtcctagtcaaagtatcgtctgtaggtgtttgccacagt
gatctacacttatgggaaggcggatatgatcttggtgatggccaatttatgaaggtcact
gatagaggtgtaaaataccctgtaactcctggacatgaaatcgttggtactgttgaacaa
atcggcgatggtgtttctaatgtatctgttggagatgctgttttagtatacccttggatt
ggatgtggacaatgtcctgcatgtaaagttggaaacgaaaatctatgtgatgctccaaaa
tccatgggcgtcttccaagatgggggttattctgattattctttaattcctgattctaaa
tatttagcaaaactcgacggtgttgatcctgatgcagctacttctattgcttgttctgga
ctaacagcatacactgctatcaaaaaggcaaatcaaaactctccagagtttctagtaatt
gtaggagctggtggacttggattaatgggagttcaaattgctagtgctattaccgatgca
aagattatctgcgttgatttagatgatgcaaaattagaaacagcaaaagaaatgggtgct
gattttacagttaactcaaaagatcctgaaactattcaaaaaataatgtctatctgtaat
gagaaaggtgcagatagtgtagtagatttcgttaatgctcctccaacagtcaaaactggt
ttagcagttttaagaaaaagaggaaatttggttttagttggtttgtttggcggttcattg
gaaatttcccttgtaacaatcccaatgaaatctattatcattcaaggtgcatacactgga
aactataatgacatggtagaacttcttgatcttgcacgaaagggcaccattaatcctgta
atttcaaaaagatattctttagatgaggcaaataatgctctagaggatctcaaagccaga
aaaattcttggtcgtgcagtaatcaatccctga

DBGET integrated database retrieval system