KEGG   Candidatus Nitrosopumilus sp. AR2: NSED_03045Help
Entry
NSED_03045        CDS       T02303                                 

Definition
ELP3 family histone acetyltransferase
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
nir  Candidatus Nitrosopumilus sp. AR2
Brite
Enzymes [BR:nir01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     NSED_03045
Transfer RNA biogenesis [BR:nir03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    NSED_03045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(499970..501556)
Genome map
AA seq 528 aa AA seqDB search
MNKLDPVVSKACNEITQNLLTIQEPSKKQVKEEIIKICTKYALERIPRNYEILSMAKESD
FDKLKKVLLRKPAKTASGVSVVALMPKPYACPHGRCTYCPGGIEFNSPNSYTGKEPSSLN
AIENEFDPKLQITSKIEKLIAFGHDPSKMEIVIVGGTFLFMPKDYQREFIKSCYDALNGI
DSKDLEEAKSNNEHASIRNVGFTIETKPDYCKKEHVDLMLSYGITRIEIGVQSLQERVYE
IVNRGHNYNDVVESFQISKDAGYKIVAHMMPGLPTMTPKGDIADFKKLFSDPELRPDMLK
IYPSLVIENTPLYEEYKQGKYTPYSDEDMIKVLTEAKRNIPKWVRIMRVQREISPKEIIA
GPKSGNLRQIVHQNLAKQGFSCKCIRCREAGLSNKKADVGEIKLNRIDYDSSGGKEVFLS
YEDKEESIYGFLRLRKPSINAHRDEIDQDTCIVREIHVYGKSLKLGEKEDDEIQHSGLGK
NLMKEAEKISKEEFDAKKILVISAVGTREYYQKLGYSLYGPYMSKVLN
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgaataagttagatcctgtggtatccaaagcatgtaatgaaatcactcagaatctatta
acaattcaagaacctagtaaaaaacaagttaaagaagaaattataaaaatttgtacaaaa
tatgcacttgaaagaattcctagaaattatgaaattctgtcaatggcaaaagaatcagat
tttgacaaattaaaaaaagtattgttaagaaaacctgccaaaacagcgtcaggagtatca
gtagtcgcattaatgccaaagccctatgcatgtccacatggacgttgtacatattgtcca
ggagggattgaatttaattcgccaaatagttacacaggaaaagaaccatcatcactaaat
gcaatagaaaacgaatttgatcctaaattacaaattacatcaaagattgaaaaattaatt
gcatttggacatgacccatccaaaatggaaatagtgatcgtaggagggacatttctcttc
atgccaaaagactatcaaagagagttcatcaaatcatgctatgatgcacttaatggaata
gattcaaaagatttggaagaggcaaaatcaaacaatgaacacgcctcaataagaaacgta
ggatttacaattgaaacaaaaccagattattgcaaaaaagaacatgttgatttaatgtta
agttatggaattacaagaatagagataggagttcaatcattacaagaacgggtttatgag
atagtcaatagaggacacaactacaatgatgtagtagaatcatttcaaatttcaaaagat
gcagggtacaaaatcgttgcacatatgatgccaggattaccaacaatgacaccaaaagga
gatatcgcagattttaaaaaattattttcagatccagagttgcgtccagatatgttgaag
atttatccttcactagtaattgaaaataccccactgtatgaagaatacaaacaaggaaaa
tacacaccatattctgatgaagatatgatcaaagttctaacagaagctaaaagaaacata
ccaaaatgggtgagaatcatgagagttcaaagggaaatttcgcccaaagagatcattgca
ggtccaaaatcagggaacttgagacaaattgtgcatcaaaatctcgccaaacagggattt
tcatgtaaatgtatcagatgtagagaagcaggattatccaacaagaaagcagatgtaggt
gagataaaattaaaccgaattgattatgattcatcaggaggaaaagaagtattcttgtct
tatgaagacaaagaagaatcaatttatggatttttgagattacgaaaaccaagtatcaat
gcacacagggatgaaattgatcaagacacatgtatcgtaagagaaattcatgtttatgga
aaatcattgaagcttggagagaaagaagacgatgagattcaacattcaggattaggaaag
aatctcatgaaagaagctgaaaaaatatctaaagaagaatttgacgcaaagaagatttta
gtaattagtgcggtaggtacaagagaatattatcaaaaattagggtattcgttatatggg
ccatacatgtccaaagtattgaattag

DBGET integrated database retrieval system