KEGG   Candidatus Nitrosopumilus sp. AR2: NSED_03390Help
Entry
NSED_03390        CDS       T02303                                 

Definition
F420-dependent oxidoreductase
Orthology
K12234  
coenzyme F420-0:L-glutamate ligase / coenzyme F420-1:gamma-L-glutamate ligase [EC:6.3.2.31 6.3.2.34]
Organism
nir  Candidatus Nitrosopumilus sp. AR2
Pathway
Methane metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:nir00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    NSED_03390
Enzymes [BR:nir01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.31  coenzyme F420-0:L-glutamate ligase
     NSED_03390
    6.3.2.34  coenzyme F420-1:gamma-L-glutamate ligase
     NSED_03390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
564156..564881
Genome map
AA seq 241 aa AA seqDB search
MQIIPIHVEKEITPSDDLSDIVLKSEKLIDGDILVIAQKIVSKQEGRLVDLSTVTPSLLA
EGISSQYQKNPKITELILSESKRIIRMSNGILIVETHHGFICANAGIDESNIEEGYATLL
PLDSDVSAQKIRKKILEHSGKNVAVIISDTFGRPFRMGQTNHAIGISGLNPILDYEGTND
SFNKILRVTAIAIADELASTSELVMGKSLKCPFAIIRGYSFESGEHGVDELIRPEHEDLF
R
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
ttgcaaataattccaatacatgttgaaaaagagatcactccttccgatgatctttctgac
attgtcctaaaatctgagaagttaattgatggtgacattctagttattgcacaaaaaatc
gtctctaaacaagaaggacgattagtagatctatctactgtaacaccttccttgttggca
gaaggtattagctcacaatatcaaaagaatcccaaaattactgaattgattttatctgaa
tcaaaaagaattatcagaatgagtaatgggatcttgatagttgaaactcatcatggtttc
atttgtgcaaatgcaggaattgatgaaagtaatattgaagaaggttatgctactttgttg
ccccttgactctgatgtctctgcgcaaaaaatcagaaagaaaattttagaacactctggc
aaaaatgttgcagtaataatttctgacacttttggtagaccatttaggatgggtcaaacg
aatcatgcaattggcatatctggtttaaacccaattttagattatgagggaactaatgat
tcttttaataaaattttacgcgttactgcaattgcaattgcagatgaacttgcatctaca
tctgagttggtaatgggaaaatcactaaaatgcccatttgcaataattcgtggatattca
tttgaatctggtgaacatggggtggatgaattaattcggcctgaacatgaggatcttttt
agatga

DBGET integrated database retrieval system