KEGG   Candidatus Nitrosopumilus sp. AR2: NSED_03630Help
Entry
NSED_03630        CDS       T02303                                 

Definition
acetate--CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
nir  Candidatus Nitrosopumilus sp. AR2
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nir00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NSED_03630
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NSED_03630
   00620 Pyruvate metabolism
    NSED_03630
   00640 Propanoate metabolism
    NSED_03630
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    NSED_03630
   00680 Methane metabolism
    NSED_03630
Enzymes [BR:nir01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     NSED_03630
Lipid biosynthesis proteins [BR:nir01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   NSED_03630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
603715..605637
Genome map
AA seq 640 aa AA seqDB search
MMSETYRIGLGNNNNSLREKANSDFVSFWDEQAKHLSWFSPWDKTLDWSPPFAKWFVGGT
INASYNALDIHQSEKSTKSAILWEGENGESRNVTYGEMFTLVQKFANVLKSLGVQKDDRV
TIYLPMVPELIVSMLACARIGAIHTVIFSGFSATSIKDRVSDSKSKIIITADGGYRRGKI
VKLKDVIDDAIKDIDFVEHVVVLERTKNKITMNPKDNLWNDLMNNISELCSAEALPSDHP
LYILYTSGTTGKPKGVLHGTGGYLTHLHSTFKWAFDIKDSDVFFCTADIGWVTGHSYVAY
APFLHGATQVMYEGAPDFPDASRMWDILQKYKVTIFYTTPTALRMFMKFGDEIPNSFDLS
NLRLLGSVGEPINPEVWKWYFKTIGKEKCPIIDTWWQTETGGMLISPLPGLESIPLKPGS
GTLPIPGVDISVVDEIGKDVPVNTKGYLVIKNPWPGMLLTLWNDDEKYKTVYWSKYENCY
YPGDYARKDEDGYLWLLGRADDVLKVAGHRIGTAELESCIVSHPSVAESAVCGIPDEVKG
EVIIAFVVLKQGVEQNSKILEKEIIDKIRNNIGSIATPKQIYFVSKLPKTRSGKIMRRLL
KAIGNNEKIGDVSTLEDGAAVTEVQQVFDELKTSIKNNLE
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
ttgatgtctgagacatatagaattggacttggaaataataataacagtttaagggaaaag
gcaaattctgattttgtatctttttgggatgaacaagcaaaacatttgtcatggttttct
ccttgggacaaaacccttgattggagccctccctttgccaaatggttcgttggaggcaca
attaatgcctcatataatgccctagatatacatcagagtgaaaaatctacaaaatctgct
atcttatgggagggtgaaaatggagaatcacgaaatgtcacatatggtgaaatgttcaca
ctggttcagaaatttgcaaatgtcctaaaatctctaggtgttcaaaaagatgacagggta
actatctatcttccaatggttccagaactcatagtttcaatgcttgcatgtgcacgaatt
ggcgcaatacatactgtaattttttctggatttagtgcaacctcaattaaagatagggtg
tctgattcaaaatctaaaattatcattactgcagatggagggtatagaagaggaaaaatt
gtaaaactcaaagatgtaattgatgatgcaataaaggatattgattttgttgaacatgta
gtggtacttgaaagaactaaaaataaaatcacaatgaatcctaaagataatctttggaat
gatttaatgaataacatttcagaactgtgctctgctgaagcattaccgagtgatcatcct
ctttacattttgtatacttcaggtactactggaaaaccaaaaggcgtgttacatggtact
ggtggatacttgactcatttgcattcaactttcaaatgggcttttgacataaaagattct
gatgtctttttttgcacagccgacatcggttgggttactggacatagttatgttgcatat
gctccatttcttcatggtgcaacacaagtaatgtatgaaggtgcacccgattttcctgat
gcgtcaagaatgtgggatattttacaaaaatacaaagtaacaattttttacacaactcct
actgcattgaggatgtttatgaaatttggagatgaaatcccaaactcatttgatctttca
aatttaagattacttggttctgtaggtgagccaataaatcctgaagtttggaaatggtat
tttaaaacaattggaaaagaaaaatgtcctatcattgatacttggtggcagactgaaact
ggaggtatgctaatatcgcctcttccgggattggaatctattcctctaaagcctggatct
ggaaccctcccaattccaggcgtagatatctcggtagttgatgaaattggaaaagatgtt
cctgtaaatacaaaggggtatcttgtaatcaaaaatccttggcctggaatgcttttgaca
ttatggaatgatgatgaaaaatacaaaacagtatactggtcaaaatatgaaaattgttat
tatcctggagactatgctcgaaaagatgaagatgggtatctttggttactgggtagagca
gatgatgttctaaaagttgcaggtcatcgaattggaactgcggaacttgagagttgtatt
gtctcacaccctagtgtggcagaatctgcagtatgtggaattccagatgaagttaaaggt
gaagtaattattgcatttgtcgttttaaaacaaggtgtagagcagaattccaaaatactg
gaaaaagaaattattgataaaattagaaataatattggatccatagcaactccgaaacaa
atctattttgtttcaaaactcccaaaaacccgcagtggaaaaataatgcgtagactacta
aaagcaattggaaacaatgaaaaaattggtgatgtgagtactttagaagatggggctgcc
gttactgaagttcaacaagtttttgatgaacttaaaacttctattaaaaataatttagaa
tga

DBGET integrated database retrieval system