KEGG   Candidatus Nitrosopumilus sp. AR2: NSED_04595Help
Entry
NSED_04595        CDS       T02303                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
nir  Candidatus Nitrosopumilus sp. AR2
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:nir00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NSED_04595
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NSED_04595
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    NSED_04595
Enzymes [BR:nir01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     NSED_04595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(747862..749199)
Genome map
AA seq 445 aa AA seqDB search
MQGDAYLKCIDPQCGLEYPIENANVQCEKGHMLDVKYKNKPPSSLKEVFYKRRDYEGSIF
NESGVWRFRDLLNFCQINTEDMEECSKYLVSLDGAEGRQSKPYHMSKAAEFVGISNNNLW
LQPEGYNPSGSFKDNGMATAVTHAKMIGAKKIVCASTGNTSASAGMFAANEGMNCDVYIP
AGQIAPGKLSQAYQFGAQIVEVDGNFDDALKQSLEDAQNHDGYTVNSINPFRIEGQKTIP
FRALEYLHWEVPDWIVYPGGALGNTSSCGKALMELYEWGWIKKIPRIAVVNSEGASTLSD
LYNGKFEGEELRWNKGNPNTELITRYYDHLDKEGLKPKTKATAIQIGRPANILKGLRALE
FTNGVVTTVSDSEMLDGMSVVGLNGFDCEMASGASVVGIKKLIEADVIKKDDVVVGILTG
RQKDAMIPVDYHRNPENRFAIPPKN
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgcaaggtgatgcttatctcaaatgtattgatccacagtgtggtttagagtatccaatt
gaaaacgcaaatgttcaatgtgagaaagggcacatgttagatgtaaaatacaaaaacaaa
cccccatcatcactcaaagaagttttttacaaaagaagggattatgaaggtagtattttc
aatgaaagtggggtttggagatttagagacttgctaaatttttgtcaaataaatacagaa
gatatggaagaatgttcaaaatatcttgtatctcttgatggagcagaaggcagacaatca
aaaccatatcacatgtcaaaagctgcagaatttgtggggatttcaaataataatttatgg
ttacaacctgaaggatacaatccaagtggttcgttcaaagataatggtatggcaacagct
gtaactcatgcaaaaatgattggtgcaaagaaaattgtttgtgcatctacaggaaataca
tctgcatcagcaggaatgtttgcggcaaatgagggaatgaattgtgatgtgtatattcct
gcagggcaaatagctccaggaaaacttagtcaagcatatcaatttggagcacaaatcgta
gaagttgatggaaattttgatgatgcattaaaacaatctctagaggatgcacaaaatcat
gatggatatactgtaaactctattaacccatttagaattgaaggacaaaaaacaataccg
tttagagcattagaatatttacattgggaagttcctgattggatcgtttatccaggaggg
gcattaggaaacacatccagttgcggtaaagcattaatggaattatatgaatggggatgg
attaaaaaaattccaagaattgcagtagttaattcagaaggtgcaagtacgttatctgat
ttgtataatggtaaatttgaaggggaagaactaagatggaataaaggaaacccaaatact
gaactaattactagatactatgatcatttggataaagaaggactaaaaccaaaaactaag
gcaaccgcaatacaaattggaaggcctgcaaatattttgaaaggtttacgggcattggaa
tttacaaatggtgttgtaactacagtttcagattctgaaatgttagacggtatgtcagta
gtaggtctaaatggatttgattgtgagatggcatcaggagcatcagtagtaggaattaag
aaattaatcgaagcagacgtcattaaaaaagacgatgtagtcgtagggattctgacaggt
agacaaaaagacgccatgatcccagtagactatcataggaatcctgagaacagatttgca
attccacctaaaaattag

DBGET integrated database retrieval system