KEGG   Candidatus Nitrosopumilus sp. AR2: NSED_04840Help
Entry
NSED_04840        CDS       T02303                                 

Definition
(RefSeq) AMP-dependent synthetase and ligase
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
nir  Candidatus Nitrosopumilus sp. AR2
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nir00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NSED_04840
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NSED_04840
   00620 Pyruvate metabolism
    NSED_04840
   00640 Propanoate metabolism
    NSED_04840
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    NSED_04840
   00680 Methane metabolism
    NSED_04840
Enzymes [BR:nir01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     NSED_04840
Lipid biosynthesis proteins [BR:nir01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   NSED_04840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(784959..786578)
Genome map
AA seq 539 aa AA seqDB search
MSNFEFIPTDKQIQESNIYKFMKKHNVLTIDELSEKAKNDLEWYWKSVDEDIGVVWDEPY
TKVLDDSKGIAWSKWFVNGKTNIYKSSVEKFNKTSPEKIAYYFESEDGKQSKISYSELNS
KVSKLANGLKSLGVKKGDVVAIYLPMIEEAILSILAAAKIGAIQTVIFSGYSAESLHIRL
KDCNAKFLIISDGFYRKGKPVSQKKSIEIAVNDTFVEKTILVPYKKIDQYTESKKIIFYD
KLVSVQNDFCDTEILDSEDPLFILYTSGTTGKPKGVIHTHGGFSVFAGHQAAYLIDMQAQ
DTLFWPADIGWITGLVWNVYGLLMMGASAVIYDGGLDFPSSDRVWRMLSEYDATIFGISP
TAVRLFKKNNVEPAKLFSLEKIKNIPTTGEPLDEDSWWWLYEKVGNKKIPIMNLSGGTEI
GGAMLSVFPGMKLKPSTVGIPVPGMNLDVVDENQSPVRGKNGFLIIKSPWPAMTRGLLND
DERYLQTYWSRFKDVWFHGDYVYVDDDNLWYMRGRTDDVINVSGHRMSTAEIEHAVISQ
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
ttgtctaattttgaatttattccaacagacaaacaaattcaagaatccaatatttacaaa
tttatgaaaaaacacaatgtcttaacaatagatgaattgtctgaaaaagctaagaatgat
ttggagtggtactggaaatcagtagacgaagatatcggagttgtttgggatgagccgtat
acaaaagtattagatgactctaaaggaattgcatggtctaaatggtttgttaacggtaaa
acaaatatttacaaatcctcagttgagaaattcaataaaacatcccctgaaaaaattgca
tattattttgaatcagaagatggaaaacaatcaaagatttcatattcagaattaaattca
aaagtatctaaacttgcaaatgggttaaaatctctcggagtcaaaaaaggtgacgtagtt
gcaatttatctgcctatgattgaagaggcaattttgtcaatacttgcagcagcaaaaata
ggtgcgatacaaacagtgattttttctggatatagtgcagaatcattacacatacgatta
aaagattgtaatgctaagtttctaataatttctgatgggttttatcgcaaaggaaaacct
gtttctcaaaaaaaatctatagagattgcagttaatgacacatttgtagaaaaaacaata
ttggttccttacaaaaaaattgatcaatacactgaatctaaaaaaattattttttatgat
aaacttgtttctgttcaaaatgatttctgtgacactgaaattttggattctgaggatcct
ttgtttattttatacacttcgggaaccactggcaagccaaaaggtgtgattcacactcat
gggggattttcagtgtttgcagggcatcaggcggcatatcttattgatatgcaggcacaa
gacacactattttggcctgcagatattgggtggattacaggtctggtgtggaatgtttat
ggtcttttgatgatgggtgcatctgctgtgatttatgatggagggttggactttccctca
tctgatagagtttggaggatgttatcagaatacgatgcaacaatttttggaatatctcca
actgccgtaagattgtttaagaaaaataatgttgaacctgcaaaattattttcattggaa
aaaataaaaaacattcctaccaccggtgaaccccttgatgaggattcatggtggtggcta
tatgaaaaagtcggaaataaaaaaatcccaatcatgaatctttctggaggtactgaaatt
ggaggtgcaatgttatctgttttccctggaatgaaattaaaaccatcgactgtaggaatt
cctgtaccgggaatgaatttggatgtagttgatgagaatcaaagtcctgttagagggaaa
aatggttttttgataataaagtctccttggcctgcaatgacacgtggtttgttaaatgat
gatgaaagatatttgcaaacatactggtctagattcaaagatgtttggtttcatggagat
tatgtgtatgtggatgatgacaatctttggtatatgcgtggacgaacagatgatgtgatt
aacgtatctggtcatcgaatgtctactgctgaaattgaacatgctgtcatatctcaataa

DBGET integrated database retrieval system