KEGG   Candidatus Nitrosopumilus sediminis: NSED_05120Help
Entry
NSED_05120        CDS       T02303                                 

Definition
(GenBank) indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
nir  Candidatus Nitrosopumilus sediminis
Pathway
nir00400  Phenylalanine, tyrosine and tryptophan biosynthesis
nir01100  Metabolic pathways
nir01110  Biosynthesis of secondary metabolites
nir01130  Biosynthesis of antibiotics
nir01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nir00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NSED_05120
Enzymes [BR:nir01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     NSED_05120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C NanE Cellulase FMN_dh His_biosynth AP_endonuc_2 ThiG
Motif
Other DBs
NCBI-ProteinID: AFS82828
UniProt: K0B9H9
Position
838773..839549
Genome map
AA seq 258 aa AA seqDB search
MAENILRKLVSNSQMAINDGVYEVDANLEKSTKDFIQIINTNLHATLLTEIKFASPSLGK
IRTLTDPVSIANQMIAGGSKALSVLTQPHLFHGSPEYFIKVREAVDVPMLMKDIMIDKIQ
IDAAKKIGADFMLVIQSLYDQKFLSDIDEFIDYGHKQGLQILLEVHTKQELQNALKTEAD
LIGINNRNLDTLEIDLKTTETILLGEEKTRPILSESGINTPEDIQYLKKCGADAFLIGSS
IMKSDNIEEEVKKLVNAY
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaaacattctacgaaaactggtaagcaattcccagatggcaattaatgacgga
gtttatgaggtggatgcaaatttggaaaaatctaccaaagactttatccaaattatcaat
acaaatctacatgcaacattgcttactgagataaaatttgcatccccatccttaggaaaa
attcgaacattaactgatccagtaagcattgcaaatcaaatgattgcaggaggctcaaaa
gccctctcagttttgactcaaccacacctatttcatggctcgccagaatatttcattaaa
gtcagagaggcagtggatgtgccaatgctcatgaaagacatcatgattgataaaatccaa
attgatgcggcaaagaagattggtgcagattttatgttagttattcaatcgctttatgat
caaaagttcctctcagatatagatgagttcatagactatggtcacaaacaaggattgcag
attttgcttgaagtacatacaaaacaagaattacaaaatgcactaaagacagaagcggat
ctcattggaattaataacaggaatttagatactttagaaatagatctaaaaactacggag
accattcttctaggagaagaaaaaacaagaccaatactatctgaaagcgggataaataca
cctgaagacatccaatatctaaaaaagtgcggagcagatgcatttctaataggatcaagc
attatgaaaagtgacaacattgaagaagaggtaaagaaattggtgaatgcatattga

DBGET integrated database retrieval system