KEGG   Candidatus Nitrosopumilus sp. AR2: NSED_05125Help
Entry
NSED_05125        CDS       T02303                                 

Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
nir  Candidatus Nitrosopumilus sp. AR2
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:nir01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:nir00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:nir00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
839546..840736
Genome map
AA seq 396 aa AA seqDB search
MKYPKNGRFGEFGGKYIPETLVPAIEELEENYLKFKNDKKFKKELDYYLKVYAGRPTPLY
YAKNLSEKIGGAKIYLKREDLLHGGAHKINNTLGQALLAKKMNKKRIIAETGAGQHGVAT
AMACAALGMKAEVYMGYRDTVRQKQNVFRMNMLGCDVHPVKSGSKTLKDAINEAIRDWIT
NVENTYYLLGSAVGPHPYPVMVRDFQSVIGNEIKSQMKKINNKAPDTVIACVGGGSNAIG
TFYPLVDTNSEIIGVEAAGHGLKSKMHSATLSVGTKGVLHGMMTYLLQDKEGQITETHSI
SAGLDYPGVGPEHSYYKDTKRVKYHAATDAEVIDAFLTLTRTEGIIPALESSHAIAEAMK
VARKSKKSESIVVTLSGRGDKDIEEVQNYLNKHVKN
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
ttgaagtatcctaaaaacggaagatttggagaatttggcggaaagtatattccagaaact
ttggtgccggcaatagaagagctagaagaaaattatcttaaatttaaaaatgataaaaaa
ttcaaaaaagaattagattactatcttaaggtgtatgcaggaagaccaacgccgctgtac
tatgcaaagaatttatctgaaaagattggcggcgctaaaatctatcttaaacgagaagac
ctgcttcatggaggagctcataaaattaacaacacgttgggtcaagcactacttgcaaaa
aagatgaacaaaaaaagaatcattgcagaaacaggagctggtcagcatggagtagcaaca
gcaatggcatgtgccgcattgggaatgaaagcagaagtatacatgggatatagagataca
gttaggcaaaaacaaaacgtatttcgaatgaacatgcttggttgtgatgtacacccagta
aaatcaggctctaaaactctcaaagatgcaatcaatgaagcaattcgtgattggattaca
aatgtagagaatacgtactatttacttggttcagcagtaggcccacatccatatcctgta
atggtgagagattttcaaagcgtgattgggaatgaaattaaatcacagatgaaaaaaatc
aacaacaaggcaccagatactgtaattgcatgtgtcggagggggttctaatgcaattgga
acgttttatccgttggtagatactaattcagagattatcggcgtagaagctgcaggccat
ggattgaaatcaaaaatgcattcagcaacattgtctgtaggaaccaaaggggttctgcat
ggaatgatgacgtacttgttacaagacaaagaaggtcagattacagagactcatagtatt
tctgcagggttagattatccaggggtgggccctgaacattcatactataaagacaccaaa
cgagtaaaatatcatgcagcaacggatgcagaagttattgacgcatttcttacattaaca
aggacagaaggaattattccagctttggaatcatctcatgcaattgcagaagctatgaaa
gttgcaagaaagagtaaaaaatctgaatcaattgtagttactctttcaggaagaggagac
aaagacatcgaagaagtacaaaattatttgaataaacatgtcaagaattaa

DBGET integrated database retrieval system