KEGG   Candidatus Nitrosopumilus sp. AR2: NSED_05130Help
Entry
NSED_05130        CDS       T02303                                 

Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
nir  Candidatus Nitrosopumilus sp. AR2
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nir00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NSED_05130
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NSED_05130
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NSED_05130
Enzymes [BR:nir01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     NSED_05130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
840723..841523
Genome map
AA seq 266 aa AA seqDB search
MSRIKEKFSELQARNQKALISYIMAGFPNEKATISTIRGLVKGGVDIIEIGFPFSDPLAD
GPVIQNASTVSLEKGTKIAKFFNLVKKIRKETDIPLILMTYTNILYHKGYAKFIVEAKRA
GIDGFILPDMSIEESKEYLKAAKNNADTIFLISPNTSKTRIQKISKVTSGFLYLVAVFGT
TGIKTGIKKYTIDAIKQVKKQTKGKIPVGVGFGVSTPDDVKKYIKAGADAVIVGSAYLKL
IEKTPQNQLESKIASFTKSLKKQTIL
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagaattaaagaaaagttttcagagttacaggctagaaaccaaaaagctctgata
tcatacattatggcagggtttccaaacgagaaagcaaccatatccaccattagaggattg
gtcaagggaggagtagatatcatagagattggatttccattttcagatcctctagctgac
ggaccagtcattcagaatgcaagtacagtatccctagaaaaaggaacaaagattgcaaag
tttttcaatcttgtaaaaaaaataagaaaagaaacagacatcccccttattctaatgaca
tataccaatattttgtaccataaaggatacgcaaaattcattgtagaagcaaaaagagca
ggtatcgatggttttattcttccagacatgtcaatagaagagtcaaaagaatacttgaag
gcagcaaagaataacgcagatacaatattcttaatttctccaaatacaagcaaaacaaga
attcagaaaatatctaaggtaacatcagggtttttgtatctggttgcagtatttggcact
acaggaataaaaacaggaattaaaaaatatacaatagatgcaatcaagcaagtcaaaaaa
cagaccaagggaaaaattccagtaggggtcggatttggagtttcaacaccagatgacgta
aaaaaatacatcaaagcaggggcagatgccgtaattgtcggaagtgcatatttgaaattg
attgaaaagaccccacaaaatcaactagagtcaaaaattgcatcatttacaaaaagtctc
aaaaaacaaacaatcctttag

DBGET integrated database retrieval system