KEGG   Candidatus Nitrosopumilus sp. AR2: NSED_05165Help
Entry
NSED_05165        CDS       T02303                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
nir  Candidatus Nitrosopumilus sp. AR2
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nir00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    NSED_05165
Enzymes [BR:nir01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     NSED_05165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(847688..848560)
Genome map
AA seq 290 aa AA seqDB search
MSFLDLYMNKNPLITASDDDSEPVATIFGIPFDATHSYKPGCRFGPDSIRDSFNNIEIFH
PELGIDLETVNIEDLGNTRHTVVASEMIDMIKKITTELVSKQRQLFILGGEHSITYGTYT
SFPKETGYVVFDAHYDLRDEFADIKLSHASYLRRIVEERGSENILHVGARAFVKEELEFL
TENKIKTITDKEIRDGKGPGLLKDYVSTFDTLYSSFDLDVLDPAFAPGVGNPEAVGITSR
ELFDMIHTFKETKVTGVDIVELNPYHDNGSTASLAAKIISTLIAINLSQK
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgagttttcttgatttatacatgaacaaaaatcctctgataactgcatcagatgatgat
tctgaacctgttgccacgatatttggaattccttttgatgcaacccattcttacaaacct
ggatgtagattcggtcctgactctattcgtgactcttttaacaatattgagatttttcat
cctgaactaggaattgatttggaaactgtcaatattgaagatttgggaaatactcgccat
accgttgttgcatcagaaatgattgatatgataaaaaaaatcaccactgagcttgtttca
aaacaaagacaattgtttattctaggtggagaacattccattacatatggaacgtacaca
agctttccaaaagaaacaggatatgttgtatttgatgcacattatgatttaagagacgaa
tttgctgatatcaaactaagccatgcatcctatttgagaagaatagttgaggaacgtggc
tctgaaaatattttgcatgtcggtgcacgtgcttttgtaaaagaagaattagagtttctt
actgaaaacaaaatcaaaacaattactgataaggaaataagagatggaaagggacctggt
cttctaaaagattatgtttcaacatttgatacgctttattctagttttgatcttgatgtt
ttagatccggcatttgcccctggtgttggaaatccagaagctgtaggcattacatcaaga
gaacttttcgatatgattcacactttcaaagaaactaaagtaaccggtgtcgatattgtg
gagttgaatccatatcatgataatggctctacagcatctcttgctgcaaaaattatctct
accttgattgccattaatctatctcaaaaataa

DBGET integrated database retrieval system