KEGG   Candidatus Nitrosopumilus sp. AR2: NSED_05220Help
Entry
NSED_05220        CDS       T02303                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
nir  Candidatus Nitrosopumilus sp. AR2
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:nir00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
855377..856321
Genome map
AA seq 314 aa AA seqDB search
MEEFSEEIYSVLEEACQETKSNVISLSGGVDSSIIAYFLKQRKPKTITVIAEDFVSTDLT
YCQMISKEMDLPLTIYNVKTTIILEAIEETIKILKNFNDIEIRNNVVMYLAIKWAKENGE
NSIITGDGADELFAGYNFLKNKSDEELEREIKRICSVMHFPTQKIGDALGVTVESPFLNE
KMISLAEKIPVNLKVKNENGKRYGKWILRKTFEKYIPQKIAWREKSPMQEGSGTVGLTNL
FDSIIGEEQFVEKKLTVEKTDGVVIRSRESMHYYEIFKKLFGNPAEPKSDEVCPYCKHHV
GKSKFCRMCGAFPI
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
ttggaagaattttctgaggaaatttacagtgttttagaagaagcatgtcaagaaaccaaa
tcgaatgtaatttcactgtcagggggagtagatagttcaatcatagcatattttctaaag
caaagaaaaccaaaaactatcacagtaattgcagaggattttgtttcaacagatttgaca
tattgccaaatgatttcaaaagagatggatttaccattaacaatttacaatgtaaaaaca
actataattttagaagcaatagaagaaacaatcaaaattttaaaaaatttcaacgatatt
gaaattcgcaataacgtagtcatgtatttggcaataaaatgggcaaaagaaaacggagaa
aactcaattatcacaggagatggagctgatgaattgtttgcaggatacaatttcctaaaa
aataaatcagatgaagagttggaaagagaaatcaaaagaatttgttctgtgatgcatttc
cctacacaaaaaattggagatgcattgggagttacagtagaatcgccttttcttaatgaa
aaaatgattagcctggctgagaaaataccagttaatctcaaagttaaaaatgaaaatgga
aaaaggtatggaaaatggattttgcgtaaaacatttgaaaaatacattccacaaaaaatt
gcatggagagaaaaatcaccaatgcaagagggttcaggaacagttggattaacaaattta
tttgattcaataataggtgaagagcaatttgttgaaaagaaattaacagttgaaaaaaca
gacggagttgtaatcagaagtagagaatcaatgcattattatgaaattttcaagaaacta
tttggcaatccagcagaaccaaaatcagatgaagtttgcccatattgtaaacatcatgtg
ggaaaatcaaaattttgtagaatgtgtggcgctttccctatctag

DBGET integrated database retrieval system