KEGG   Candidatus Nitrosopumilus sp. AR2: NSED_05415Help
Entry
NSED_05415        CDS       T02303                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
nir  Candidatus Nitrosopumilus sp. AR2
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nir00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NSED_05415
   01230 Biosynthesis of amino acids
    NSED_05415
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NSED_05415
   00051 Fructose and mannose metabolism
    NSED_05415
   00562 Inositol phosphate metabolism
    NSED_05415
Enzymes [BR:nir01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     NSED_05415
Exosome [BR:nir04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   NSED_05415
  Exosomal proteins of bladder cancer cells
   NSED_05415
  Exosomal proteins of melanoma cells
   NSED_05415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
889569..890225
Genome map
AA seq 218 aa AA seqDB search
MFVINCKNYEEIAGDKIVKFVKTAEKISKKYKIKIAISPPQHLIGLVSNSSIPILAQHVD
DSKVGSTTGFVIPELLKKSRVKGSLINHSEHRISSKEIEKLILKLKELKMISILCVKDVA
EVKKYAKFNPDYIAIEPPELIGSGKAVSKEKPELIAKAAKAIKNAKNSTKLLCGAGIVSG
EDVSKAIELGSKGILVASGIIKAKDWNKIMADFAKSMV
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgtttgtaattaattgtaaaaattatgaagaaattgcaggagataaaatagtcaaattt
gtaaaaacggcagaaaaaatttccaaaaaatataaaataaaaatagcaatatcaccacca
cagcatctaattggattggtatcaaatagttcaattccaattttagcccaacatgttgat
gactcaaaggttggaagcactacaggatttgtgattccagaattattaaaaaaatctaga
gtcaaaggatcattaatcaatcacagcgaacatagaatttccagtaaagaaattgaaaaa
ttaattttaaaattaaaagaattaaaaatgatatctattttatgtgtaaaagatgttgcc
gaagttaaaaaatatgcaaaattcaatccagattatattgcaatagaacctccggaatta
attggatcgggcaaagcagtttctaaagaaaaaccagaattaatcgctaaagccgcaaaa
gcgataaagaatgcaaaaaatagtacaaaattactttgtggtgcgggaattgtttcagga
gaagatgtgtcaaaagccatagaattaggatccaagggaatcttagttgcaagtggaatt
atcaaagcaaaagactggaataagattatggcagattttgccaagtcaatggtttaa

DBGET integrated database retrieval system