KEGG   Candidatus Nitrosopumilus sp. AR2: NSED_05415Help
Entry
NSED_05415        CDS       T02303                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
nir  Candidatus Nitrosopumilus sp. AR2
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nir00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NSED_05415
   01230 Biosynthesis of amino acids
    NSED_05415
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NSED_05415
   00051 Fructose and mannose metabolism
    NSED_05415
   00562 Inositol phosphate metabolism
    NSED_05415
Enzymes [BR:nir01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     NSED_05415
Exosome [BR:nir04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   NSED_05415
  Exosomal proteins of bladder cancer cells
   NSED_05415
  Exosomal proteins of melanoma cells
   NSED_05415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
889569..890225
Genome map
AA seq 218 aa AA seqDB search
MFVINCKNYEEIAGDKIVKFVKTAEKISKKYKIKIAISPPQHLIGLVSNSSIPILAQHVD
DSKVGSTTGFVIPELLKKSRVKGSLINHSEHRISSKEIEKLILKLKELKMISILCVKDVA
EVKKYAKFNPDYIAIEPPELIGSGKAVSKEKPELIAKAAKAIKNAKNSTKLLCGAGIVSG
EDVSKAIELGSKGILVASGIIKAKDWNKIMADFAKSMV
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgtttgtaattaattgtaaaaattatgaagaaattgcaggagataaaatagtcaaattt
gtaaaaacggcagaaaaaatttccaaaaaatataaaataaaaatagcaatatcaccacca
cagcatctaattggattggtatcaaatagttcaattccaattttagcccaacatgttgat
gactcaaaggttggaagcactacaggatttgtgattccagaattattaaaaaaatctaga
gtcaaaggatcattaatcaatcacagcgaacatagaatttccagtaaagaaattgaaaaa
ttaattttaaaattaaaagaattaaaaatgatatctattttatgtgtaaaagatgttgcc
gaagttaaaaaatatgcaaaattcaatccagattatattgcaatagaacctccggaatta
attggatcgggcaaagcagtttctaaagaaaaaccagaattaatcgctaaagccgcaaaa
gcgataaagaatgcaaaaaatagtacaaaattactttgtggtgcgggaattgtttcagga
gaagatgtgtcaaaagccatagaattaggatccaagggaatcttagttgcaagtggaatt
atcaaagcaaaagactggaataagattatggcagattttgccaagtcaatggtttaa

DBGET integrated database retrieval system