KEGG   Candidatus Nitrosopumilus sp. AR2: NSED_05970Help
Entry
NSED_05970        CDS       T02303                                 

Definition
(GenBank) hypothetical protein
Organism
nir  Candidatus Nitrosopumilus sp. AR2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(991280..993088)
Genome map
AA seq 602 aa AA seqDB search
MLECEQFIYTAAKTPEKEGYQIIAQSEGITPQIVSQLAGYLYPIGTNIEKFEESRSLVLL
DNHKIAYSIVKNIGVGYDGRRGTLYNHTFILNQDEFEKLGFDSRNLDDYFTLNVKSHGIL
DKIQLKPSSKKINFDVFSNLDENILSHLLNSITQAKKTAIIGFDHYDLIQNILMVLPESL
RLVSFSSHVFEPKRQNEYDIIQSPPDIEFSKKWTIIPIKNIIGYKKKLNFPILDFQYIAN
LVIEKNESGIKQFHEKIMNMHELSTYEAMKLINYENLSQNTTDPEKISIYLLECAKTTKK
IDSSLTLDYLKKAKQYCMKSNNKNLLDQIETGEILQEIIESPLNVKLIENALKRTDEYEL
KKTFINKIVKLKNKEIKNNFYDFLEDINDSDYADEFIKSFFQYKNLKSLLLIFIKNPPYW
KKKLLSNIIEKILSNSSGVDPIFLNDALLNFKIKFDSIDEIEKTKNILHSSLNNHEFRNN
VPPKTLLSFTENLILEIKNHIMKNTRASKNKSLEWTSSENFSKFKTYSNDMLTNLLHCLG
YVKEYRTTEFTPSLKKKYSTILLERKSLMKKLQSIKMTKKTNKKESEPNIVFNPFKLWWP
WS
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
ttgttagaatgtgaacaatttatctacactgcagctaagacgcctgaaaaagaaggctat
caaataattgcacaaagtgaaggtataacaccacaaatagtttctcaactagctggctat
ctttatccaataggtacgaatattgaaaaatttgaagaatctagaagcttagtattactt
gataatcacaaaattgcgtatagtatcgtaaagaatataggagttggttatgatggaaga
cgaggaactctctataatcatacatttattttaaatcaagatgaatttgaaaaattagga
tttgattcaagaaatttagatgattattttactttaaatgtaaaatcacatggaatttta
gataaaattcaacttaaaccaagttctaaaaaaattaatttcgatgtctttagtaatctt
gatgaaaatattttatctcatctgttgaattcaattacacaagcaaaaaaaacagcaata
atcggatttgatcactatgatttaattcagaatattttgatggttttgcctgaatcttta
cgattagtttctttttcttctcatgtatttgaacctaaacgtcagaatgaatatgacata
attcaatccccacctgatattgaatttagcaaaaaatggacaataataccaataaaaaat
atcattggatataagaaaaaattgaattttccaatattggattttcaatatattgcaaat
ttagttatagaaaaaaatgaatctggaataaaacaatttcatgaaaaaataatgaatatg
catgagctatctacctatgaagcaatgaaattgattaactatgaaaatttatctcaaaat
acaactgacccagaaaaaatttctatttatttattagaatgtgcaaaaacaactaaaaaa
atagattcttctttaacattagattatcttaaaaaagctaaacagtattgtatgaaatca
aataataaaaatctattagatcaaatagaaacaggtgaaattctacaagaaatcattgaa
tccccactaaatgttaaactaattgaaaatgcattaaaacgaactgatgaatatgaactc
aaaaaaactttcattaataaaatagtgaaattgaaaaataaagaaataaagaataacttt
tatgattttctagaagatattaatgattcagactatgctgatgaattcatcaaatctttc
tttcaatataaaaatctgaaatctcttttacttatttttatcaaaaatcctccatattgg
aagaaaaaactgctatcaaatattattgaaaaaattttatctaattcttcaggggtcgat
ccaattttcttaaatgatgcattacttaatttcaaaatcaaatttgattcaatcgatgag
attgaaaagactaaaaatattcttcatagttccttaaacaatcatgaatttaggaataat
gtacctccaaaaacacttctttcatttacagaaaatttaattttagaaataaaaaatcac
ataatgaaaaatacacgagcatcaaaaaataaaagtcttgagtggacatcctctgaaaat
ttttctaaatttaaaacatattctaatgatatgttgactaaccttctacattgtttagga
tatgttaaagaatatagaacaactgaattcactcccagtcttaagaaaaaatactctaca
attcttttagaacgaaaatctcttatgaaaaaactacaatcaatcaaaatgactaaaaaa
acgaataaaaaagaatctgaaccaaatattgtatttaatccctttaaattgtggtggcca
tggtcttaa

DBGET integrated database retrieval system