KEGG   Candidatus Nitrosopumilus sediminis: NSED_06000Help
Entry
NSED_06000        CDS       T02303                                 

Definition
(GenBank) integrase family protein
Organism
nir  Candidatus Nitrosopumilus sediminis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_integrase Phage_int_SAM_4 Phage_int_SAM_5 Phage_int_SAM_1
Motif
Other DBs
NCBI-ProteinID: AFS83002
UniProt: K0BD62
Position
complement(997929..999116)
Genome map
AA seq 395 aa AA seqDB search
MENTNPNTNSSTEPESIALSKASNGYQYMKLKKWNECREFEIWIGTVNPNTQRTYTENMG
YFVNWSQSTKHPIGMINELIEHPKEILNEILEDYMVYLKKRGLSRNTVKLYMAGIESFLI
FHEVSYSEKKIKRLLPPRQKLAGKNAYKLEQIQAMLDSTSILRMKVIVMLSACSGVRKGG
LAHLKVGDLVPIENCYAIKVYNGEIEEYITFCTPETRTVIDQYFEWRKDGGEVITPESML
LQMDSTTPRTGPNAGRDQIIAHALFMLLRKAGIKKERVGKNRYNISMAHGFRKFFNTQLN
IAHVDHNAIEKMMGHKNGLKGGYNDAEIPNLFEEYKKAIPNLTLLEKNRQKAIIDELKSR
SVRDEVMLTKEVIDMKQKMERIERELELHRNAVTF
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacactaatccaaacacaaatagttcgaccgaacctgaatcgatagccttaagt
aaagcctctaatggttatcagtatatgaaactgaaaaaatggaacgaatgcagagaattc
gagatatggataggcacagttaacccaaacacacagcgtacttacactgaaaatatgggg
tattttgtaaactggtcacaatccaccaaacatccgatcgggatgattaatgaactcata
gagcatccaaaggaaatcctcaacgaaatactggaagattacatggtgtatctaaagaaa
cgaggactgtcacgaaacactgtaaagttgtacatggcaggtattgagagctttttgatt
tttcatgaggtttcttactctgaaaaaaagatcaagcgtttgctaccgccacggcaaaaa
ctggcaggcaagaacgcctacaaactagagcaaatacaggcaatgctggatagtacatct
atccttagaatgaaagtcattgtgatgctttctgcttgcagtggtgtcagaaaaggtggc
cttgctcacttgaaggtgggtgatttggtacccatcgaaaactgttatgccattaaggtt
tacaacggtgagatagaagagtatattacattctgtacacctgaaaccagaaccgtaata
gatcaatactttgaatggagaaaggatggtggtgaagttatcacccctgaaagcatgctg
ttacaaatggacagcaccacaccaagaactggcccaaatgcaggtagggatcaaataata
gcccatgcgttgttcatgctgttaagaaaagcaggcatcaagaaagaacgggtcggtaag
aacagatacaatatttccatggcacatggatttagaaagttcttcaatacccaactcaac
attgctcatgttgatcataacgccatcgaaaagatgatgggacacaagaatggattgaag
ggaggatacaatgatgcagaaatcccaaatttgtttgaagaatacaaaaaggcaatacca
aacctgacactcttggagaagaacaggcagaaagccatcatagacgagttgaaaagcaga
tcagttcgtgatgaggtgatgctcaccaaagaggtcattgacatgaaacaaaagatggag
cgtatagaacgtgagttagagttacaccgtaacgcagtcactttctaa

DBGET integrated database retrieval system