KEGG   Candidatus Nitrosopumilus sediminis: NSED_06030Help
Entry
NSED_06030        CDS       T02303                                 

Definition
(GenBank) heat shock protein DnaJ domain-containing protein
Organism
nir  Candidatus Nitrosopumilus sediminis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DnaJ Fer4_13 Fer4_15 Fer4_19 Fer4
Motif
Other DBs
NCBI-ProteinID: AFS83008
UniProt: K0B9X6
Position
1001968..1002684
Genome map
AA seq 238 aa AA seqDB search
MQLFLTYNKPLLLVNTYQALRVLNVDSSSSQEEIKTAYRKLALEHHPDKNQGKTEDGEFK
KITEAYNHLKKNHNQHSSPYHNVTRTQQKPKEDFKRKPQWGAPDDGGIPEQDWSKYTREF
EEGDPDFWKEYEKKFWEDYNARVRPDGRNGEYEKAQEPKKQPDLFVDVDKSLCIGCCSCE
TIAPEVFEINKTSKSNPKSSVINQKGAGINKIMNAAETCPTKAIKVENKNTKEKLFPY
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgcaattatttttaacgtataacaaacccctattgctagtgaatacataccaagcactc
agggtacttaatgttgattcaagttcatcgcaagaggagattaaaacagcatatagaaag
ctggcactagagcaccatccagataaaaatcaaggcaaaacagaagatggggaatttaag
aaaatcacagaagcatataatcacctaaagaaaaatcacaatcagcattcttcaccatac
cataatgtaactagaacacagcaaaagccaaaagaagattttaaaagaaaaccacagtgg
ggggcaccagatgatggaggcatcccagaacaagattggagtaaatatacacgggaattt
gaggaaggagatccagacttttggaaagaatatgaaaaaaaattttgggaagattacaat
gcaagagtacgcccagatggaaggaatggagagtatgaaaaagcacaagaacctaaaaag
caacctgatctttttgtagatgttgacaaaagcttgtgtataggatgttgtagttgtgaa
actattgcaccagaagtttttgaaatcaataaaacaagtaaatcaaaccccaaatcatca
gtgattaatcaaaaaggggcaggaattaacaaaataatgaatgctgcagaaacatgtcca
acaaaagcaatcaaggtagaaaacaaaaatacaaaagaaaaattattcccatattag

DBGET integrated database retrieval system