KEGG   Candidatus Nitrosopumilus sp. AR2: NSED_06050Help
Entry
NSED_06050        CDS       T02303                                 

Definition
(GenBank) NADPH-dependent FMN reductase
Organism
nir  Candidatus Nitrosopumilus sp. AR2
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1003772..1004347
Genome map
AA seq 191 aa AA seqDB search
MKPKILAFAGSTRTDSFNKKLIRIAVSGASDAGADVTTIDLRDFQMPLYDGDLEQNEGLP
QNVQKLKELMLSHQGFLISAPEYNSSITGVLKNTIDWTSRQSENETPLACYKGKVAGIMS
ASPGGLGGLRGLVHVRAILENMGVLVIPEQIAVSAAHEAFDVDNLLKDKKQEEKVKKIGA
NLTKILAKLSN
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccaaaaattcttgcgtttgctggaagcactaggactgattcatttaacaaaaaa
ctaatccggattgctgtatcaggtgcatcagatgctggtgcagatgttacaacaatcgat
ctacgtgattttcagatgccactttatgatggagacttggaacaaaatgagggtcttcct
caaaacgtacaaaaactaaaggaattgatgttatcacatcaaggctttctaatttctgca
ccagagtacaatagctccataacaggagtgctaaaaaacaccatagactggacgtctcgt
caatctgaaaatgaaactcctttagcttgttacaaaggaaaggttgcaggaataatgagt
gcgtcacctggtggattaggaggacttagaggattggtacatgttcgtgccattcttgaa
aatatgggggtactggttatcccagaacagattgctgtttctgcagcccatgaagctttt
gatgttgataatttacttaaagacaaaaaacaagaagaaaaagtaaaaaaaattggtgcc
aatcttacaaaaatattggcaaaattatccaattaa

DBGET integrated database retrieval system