KEGG   Candidatus Nitrosopumilus sp. AR2: NSED_06095Help
Entry
NSED_06095        CDS       T02303                                 

Definition
hypothetical protein
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
nir  Candidatus Nitrosopumilus sp. AR2
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nir00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NSED_06095
   01230 Biosynthesis of amino acids
    NSED_06095
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NSED_06095
   00030 Pentose phosphate pathway
    NSED_06095
   00051 Fructose and mannose metabolism
    NSED_06095
  Energy metabolism
   00680 Methane metabolism
    NSED_06095
Enzymes [BR:nir01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     NSED_06095
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     NSED_06095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1010109..1011242
Genome map
AA seq 377 aa AA seqDB search
MKITVSVIKADVGGVGGHTKPSDGLIEAIRNTVKNSADLLIDYYIGYCGDDTHIVMTHTH
GVDNQQIHKLAWDAFMAGTQVAKDEGLYGAGQDLLKDSFSGNVKGMGPGVAEMEFEERPN
EAFTVFAADKTEPGAFNYPIYRMFVDALSNTGLIVNKSLAAGVTMHIMDVEKAQIAELHL
WEDKPTIEAALMYPGRYVVDSVYTKDGEPILDASTDRLHNIAGTYVGKDDPICLVRTQKN
FPATEEVGSVFNNPHYVAGNTRGSHNMPLMPVKLNSAATINFCIPIVEALVFSMHNGKLT
GPFDGFSTPDWDYIREIATKKAMAIRSQGFIHPATLVPSELEYAEGYRARMDVLETKMKP
MEGTSSGEKKENYEDPD
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattacagtttcagttatcaaagcagatgtcggcggagttggcggacatacaaaa
ccaagtgatggactaatagaagcaattagaaacaccgtcaaaaattcagcagatttactc
attgattattacataggatattgtggggatgatacccatattgtaatgacacatactcat
ggtgtagacaatcaacaaattcacaaattagcatgggatgcattcatggcaggaactcaa
gtagcaaaagatgaaggattgtatggtgcaggacaagatttgttaaaagattctttttca
ggaaatgtaaaaggaatgggaccaggagttgcagaaatggaatttgaggaaagaccaaac
gaagcattcacagtatttgcagctgacaaaacagaaccaggtgcattcaactatccaatc
tacagaatgtttgtcgatgcactaagcaacacaggtcttattgtaaacaaaagtcttgca
gcaggagtaacaatgcacatcatggatgtagagaaagcacaaattgcagaattgcattta
tgggaagacaagccaactatcgaagctgcattaatgtatccaggaagatatgtggtagat
tcagtgtatacaaaagacggagaaccaatactagatgcatcaactgacagattacataac
attgcaggaacatatgttggaaaagacgatccaatttgtctagtaagaactcaaaagaac
tttccagcaacagaagaagtaggaagtgtatttaacaatccccattatgttgcaggaaac
acaagaggtagtcacaacatgccattaatgcctgtaaaactaaattcagcagctacaatc
aacttttgtattccaattgttgaagcattagtgttcagcatgcataatggaaaacttaca
ggtccatttgatggattctcaacaccagactgggattacatcagagaaattgcaacaaag
aaagccatggcaattagaagtcaaggatttattcatccagcaacactcgttccatccgaa
ttagaatatgctgaaggatacagagcaagaatggatgttcttgaaacaaagatgaaacca
atggaaggaacatccagcggcgaaaagaaagaaaactacgaagatccagattag

DBGET integrated database retrieval system