KEGG   Candidatus Nitrosopumilus sp. AR2: NSED_06125Help
Entry
NSED_06125        CDS       T02303                                 

Definition
(GenBank) hypothetical protein
Organism
nir  Candidatus Nitrosopumilus sp. AR2
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1015254..1015490)
Genome map
AA seq 78 aa AA seqDB search
MHDTESDTFVYQSWPEKFADMLKKIGVDSEPKEIGTDEVEKDDYYSRYFAQTPRMVTNRG
CIDIKNSNIDVVQIIQKG
NT seq 237 nt NT seq  +upstreamnt  +downstreamnt
atgcatgatacagagtctgacacatttgtctatcaatcatggcctgaaaaatttgctgat
atgttaaaaaagatcggtgttgattccgaaccaaaagaaattggaactgatgaagttgaa
aaagatgattactatagtagatattttgctcaaacacctagaatggtaactaatcgtgga
tgtattgatatcaagaattctaacattgatgttgtacaaataattcaaaagggataa

DBGET integrated database retrieval system