KEGG   Candidatus Nitrosopumilus sediminis: NSED_06140Help
Entry
NSED_06140        CDS       T02303                                 

Definition
(GenBank) hypothetical protein
  KO
K07090  uncharacterized protein
Organism
nir  Candidatus Nitrosopumilus sediminis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE CCB1
Motif
Other DBs
NCBI-ProteinID: AFS83030
UniProt: K0BDB2
Position
complement(1018058..1018825)
Genome map
AA seq 255 aa AA seqDB search
MIDQLWLIPLGFAAGILGSMIGLGGGVIVVPVLTFLGFPPTAAASNSLFAALSNAIASTI
SYSKQKRIEYPLGLKLGLLSIPGTVLGALISSDVAPDVFKILFGFVLIASAAYIFLRKKI
ETREKTISKQMTVFAIGASFFAGIISSFFGIGGGIIFVPLMVVGMGMAMKKAAPTSQMIL
LFASFSGVVVHSLLGHPDFFQAGLLAIGSFIGGLVGARLSIDIKERYLQILVSVVILIAS
AKLFYDSLSGNVFGF
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgattgatcaattatggctaattcctctggggtttgcagctggaattttaggttctatg
attggtcttggtggtggagtaattgttgtcccagtcttgacttttctgggatttcctcca
actgctgctgcaagtaacagtttgtttgctgcattaagcaatgcaattgcatctacgatt
tcttattcaaaacaaaaacgaatcgaatatcctttaggtcttaaactaggtttgctttca
attcctggaaccgttttgggtgcattgatttctagcgatgttgcacctgatgtttttaaa
atactgtttggatttgtattaattgcatctgctgcatacatatttttgagaaaaaaaatt
gaaactagagaaaaaacaatttcaaaacaaatgacggtctttgcaattggcgcaagcttt
tttgcaggaattatctcttctttttttggtattggagggggaataatctttgttccttta
atggtagttggcatgggaatggccatgaaaaaagctgcacccacatcccaaatgattctc
ttgtttgcatcattttctggagttgttgtacacagtttgttgggacaccctgatttcttt
caagcaggactgcttgctattggttcttttatcgggggattagttggcgcgagattatcc
attgatatcaaagaacgctatttgcaaattctggtttctgtagttattctaattgcatct
gcaaaattattctatgattctttatctggtaatgtattcggattttag

DBGET integrated database retrieval system