KEGG   Candidatus Nitrosopumilus sp. AR2: NSED_06155Help
Entry
NSED_06155        CDS       T02303                                 

Definition
(GenBank) hypothetical protein
Organism
nir  Candidatus Nitrosopumilus sp. AR2
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AFS83033
UniProt: K0B9Z1
Position
complement(1020058..1020408)
Genome map
AA seq 116 aa AA seqDB search
MVDPLKERLDKLKKFSDSAKRRANLYAEVTSIDDKHTARSLGALQKAPAPGKKLQKIGFL
MLWVPEPTGVTCAIGGPMIVAGRYLDKKYNGSTIHDVGHTTKHTMSSISDFKNSVM
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atggttgatcctctaaaggaacgtctagataaattaaaaaaattctctgactctgcaaaa
cgtagggcgaatttgtatgctgaagttactagtatagatgacaagcatactgcccggtca
ttaggtgctcttcaaaaagctccagctcctggcaaaaaactgcaaaaaattggattttta
atgttatgggttcctgaacctactggagttacttgtgctattggagggccaatgattgtt
gcaggacgatatcttgacaagaaatacaatggttcaacaattcatgacgttgggcatact
acaaaacatacaatgtcttcaattagtgattttaagaattcagtaatgtaa

DBGET integrated database retrieval system