KEGG   Candidatus Nitrosopumilus sediminis: NSED_06160Help
Entry
NSED_06160        CDS       T02303                                 

Definition
(GenBank) DtxR family iron dependent repressor
Organism
nir  Candidatus Nitrosopumilus sediminis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe_dep_repress Fe_dep_repr_C DUF4423 HTH_12 TrmB MarR HTH_45 MarR_2 LexA_DNA_bind HTH_27 HTH_24 HTH_Crp_2 DUF2250 HTH_6 HTH_5 FeoC HTH_IclR Rrf2 PAX
Motif
Other DBs
NCBI-ProteinID: AFS83034
UniProt: K0BC38
Position
1020543..1021007
Genome map
AA seq 154 aa AA seqDB search
MKSKNSKRLDSIKAAHQSERARSSTRMEDYLEIISELVELKGYATTLDISRYMNVSAPSV
TKMLQRLDENGFLEYEKYHGINLTEKGIEIAEGIRQKHGILLEFFEILGVGYDTANQDTE
GIEHHLNPKTIKQLRKFITFLKANPKIIENFKNL
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgaaatctaaaaattctaaaagattggattcaatcaaagctgcacaccaatcagagaga
gcacgttctagtacaagaatggaagattatttggaaatcatttcagaactagtggaatta
aaaggatatgccacaacattggatatttcaagatacatgaatgtcagtgctccaagtgta
accaaaatgctgcaaagacttgatgagaatggatttttagaatatgagaaatatcatgga
attaatctaactgaaaaaggcatagagattgcagaaggaataagacaaaaacatgggata
ttgttagagttctttgaaatcttaggggtaggatatgacactgcaaatcaagatacagag
ggaattgagcatcacttgaatcctaaaacaatcaaacagttaagaaagttcataacgttt
ttgaaagcaaatccaaagattattgagaattttaaaaatctttaa

DBGET integrated database retrieval system