KEGG   Candidatus Nitrosopumilus sp. AR2: NSED_06165Help
Entry
NSED_06165        CDS       T02303                                 

Definition
(GenBank) ATPase
  KO
K06865  
ATPase
Organism
nir  Candidatus Nitrosopumilus sp. AR2
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1020994..1022814)
Genome map
AA seq 606 aa AA seqDB search
MTKIVSDTSVIINGQLTAQIESGSIRNSDIIIPQAVFDELQSQASKNKEQGFIGLERIQK
LKSLSGSHGLNVVVSGSHPSSDDIKLASSGRIDALIVDMAKQNNAILYTSDNVQHLVARA
EGVETVFLKSEIKNESLEFLKFFDSETMSIHLKENQCPLAKKGKPGEFVLTKLSDEILSK
DYLEMISSQILDVVNVYDSSTLEISKNGASVVQHGDYRIAITYPPFSESFEITIVHPIVK
LSLDDYTISEKLMERFSDSAEGIVISGAPGSGKSTLASGLANFYHKKGKIVKTFESPRDL
QVDPGVTQYSKLDGSFDNSADILLLVRPDYTIFDEVRRREDFGTFADLRLTGVGMVGVVH
ANSPLDAIQRFIGKIELGIIPNVLDTVVFVKDGGIQKVYDLELKVKVPTGMTESDLARPV
IEIRNFEDNVLEHEIYTFGEENVIVPVGKKADKVGIEKLAEDKIKETFKRYDPRAEVEIL
SDNRVKVMVDEQYIPSIIGRGGSNINEIEKLLRVHIDVVQKTSDDISLTTNDLPFSFSES
KTALLLTVNRDFSSMHADIYANEKFIASVRIGKKGQIKIPKRSDVARTLMDFSRSQSDIK
IFLKDF
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
ttgacaaaaattgtttctgatactagtgtaataattaatggtcagcttactgctcaaatt
gaatctggcagtattagaaattctgatatcattattccacaagctgtttttgatgaactt
caatctcaagcatcaaagaacaaagaacaaggattcattgggctggaaagaattcaaaaa
ctcaaatccttatctgggagtcatgggttaaatgttgttgttagtggttctcacccttct
tctgatgatatcaaacttgccagcagtggcaggatagatgctctaattgtcgacatggca
aagcaaaataatgctatattgtacacttctgataatgtacagcatttggttgcgcgtgct
gaaggcgtcgaaacagtatttttaaaatctgaaataaaaaatgaatctttggaatttcta
aaattttttgattctgaaactatgagcatacatcttaaagaaaatcagtgtcctttggca
aaaaaaggcaagcctggggaatttgtgctgacaaaactaagtgatgagattctttcaaag
gattatttggaaatgatctcatcacaaattttagatgtagtaaatgtgtatgattctagc
accttggagatatccaaaaatggtgcttctgtagttcaacatggcgattatagaatagct
attacatatcctcctttttcagaatcttttgagattacaatagtgcatcctattgtgaag
ttatcccttgatgattacacaatttctgaaaaattaatggagcgtttttctgacagtgcg
gaaggcattgtgatttcaggagctcctgggtctggaaaaagcactcttgcctctggtctt
gcaaatttctatcataaaaaaggaaagattgtaaaaacattcgagtctccacgtgattta
caagttgatcctggagttacccaatacagtaaacttgatggaagttttgacaattctgca
gatattttattacttgtaagaccagattatacaatttttgatgaagtaagaagacgcgaa
gattttggaacttttgctgacttgagattaactggggttggtatggtgggagtcgttcat
gcaaattccccattggatgcaattcaacgttttattgggaaaattgagcttggaataatt
ccaaatgttttggatactgtagtttttgtaaaagatggtggaattcaaaaagtgtatgat
ttggaattaaaagttaaagtcccaactggtatgactgaatccgatttggctcgacctgta
attgaaattagaaattttgaagataatgttttggaacatgaaatttacacatttggtgaa
gaaaatgtcatcgttcctgtaggaaaaaaggcagataaagttggaattgaaaaactagct
gaagacaaaattaaagaaacattcaagcgttatgaccctcgcgctgaagttgaaatttta
tctgacaatagagtcaaagtcatggtcgatgaacaatacattccatctattattggcaga
ggtggctcaaacattaatgaaatcgaaaaattactccgtgtacatattgacgttgttcaa
aaaacatctgatgatatctcactgaccactaatgatttaccatttagtttttcagaatca
aaaactgcattactgctaactgtaaatagagattttagctcaatgcatgctgacatctat
gcaaatgagaaatttattgcatctgttagaattggtaaaaaaggacaaataaaaattcca
aagcgttctgatgttgcaagaaccttgatggatttttctaggtcccaaagtgatatcaaa
atcttccttaaagatttttaa

DBGET integrated database retrieval system